Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TPI2

Protein Details
Accession N4TPI2   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-89LIVRTRKRKAFFPRRQLPKGSPHydrophilic
NLS Segment(s)
PositionSequence
70-86VRTRKRKAFFPRRQLPK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MDQWNDYFKKGTLQDFQRLCADLGLPSNLPSKTKCRDALKSINVNIKQFLQCETKPDDVELFKNRKELIVRTRKRKAFFPRRQLPKGSPLRTLLKHMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.47
4 0.43
5 0.41
6 0.36
7 0.28
8 0.23
9 0.16
10 0.16
11 0.16
12 0.13
13 0.13
14 0.16
15 0.16
16 0.17
17 0.18
18 0.23
19 0.26
20 0.31
21 0.37
22 0.39
23 0.44
24 0.5
25 0.56
26 0.57
27 0.58
28 0.56
29 0.56
30 0.52
31 0.47
32 0.4
33 0.34
34 0.28
35 0.22
36 0.22
37 0.2
38 0.18
39 0.21
40 0.24
41 0.24
42 0.23
43 0.23
44 0.22
45 0.19
46 0.23
47 0.26
48 0.26
49 0.25
50 0.27
51 0.27
52 0.27
53 0.29
54 0.31
55 0.34
56 0.41
57 0.48
58 0.55
59 0.65
60 0.68
61 0.68
62 0.71
63 0.72
64 0.72
65 0.75
66 0.76
67 0.77
68 0.81
69 0.84
70 0.81
71 0.75
72 0.74
73 0.74
74 0.67
75 0.62
76 0.58
77 0.6
78 0.56
79 0.59