Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4UHV4

Protein Details
Accession N4UHV4    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVKPLTFKGDKKVKKRKRTDPEKSQRDGVDBasic
NLS Segment(s)
PositionSequence
9-19GDKKVKKRKRT
206-234RFKPKLRASKEEKALAKISRRELEEAAGR
242-248RKLKRAR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKVKKRKRTDPEKSQRDGVDDEAGQLQKTGEDAENDDSWVSAEAATDVVGPIMIVLPTDEPSALACDTTGKVFTIPIENIVDGNPTTAEPHDVRQVWVANRVAGTENFRFKGHHGRYLSCDKIGLLSATSEAVSPLESFNVIPTGDTPGTFQLQTLRDTFLTIKAPSKASSKAVDVRGDADTISFDTTFRIRMQARFKPKLRASKEEKALAKISRRELEEAAGRRLDEDEVRKLKRARREGDYHEALLEIKVKSKHDKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.9
3 0.9
4 0.91
5 0.94
6 0.94
7 0.94
8 0.95
9 0.93
10 0.87
11 0.83
12 0.73
13 0.66
14 0.57
15 0.48
16 0.42
17 0.33
18 0.3
19 0.28
20 0.26
21 0.22
22 0.2
23 0.17
24 0.12
25 0.12
26 0.13
27 0.1
28 0.11
29 0.14
30 0.18
31 0.18
32 0.18
33 0.17
34 0.15
35 0.13
36 0.13
37 0.11
38 0.07
39 0.06
40 0.06
41 0.06
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.03
49 0.04
50 0.04
51 0.03
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.06
58 0.07
59 0.09
60 0.09
61 0.08
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.08
68 0.08
69 0.09
70 0.1
71 0.12
72 0.11
73 0.13
74 0.13
75 0.13
76 0.13
77 0.13
78 0.13
79 0.09
80 0.09
81 0.07
82 0.06
83 0.07
84 0.07
85 0.1
86 0.1
87 0.12
88 0.17
89 0.17
90 0.18
91 0.19
92 0.22
93 0.2
94 0.24
95 0.23
96 0.18
97 0.18
98 0.18
99 0.17
100 0.15
101 0.18
102 0.16
103 0.19
104 0.19
105 0.2
106 0.19
107 0.2
108 0.29
109 0.27
110 0.31
111 0.3
112 0.31
113 0.35
114 0.41
115 0.4
116 0.29
117 0.27
118 0.2
119 0.19
120 0.17
121 0.12
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.05
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.05
137 0.06
138 0.05
139 0.05
140 0.06
141 0.1
142 0.1
143 0.1
144 0.1
145 0.11
146 0.12
147 0.12
148 0.12
149 0.13
150 0.14
151 0.16
152 0.16
153 0.17
154 0.15
155 0.17
156 0.17
157 0.15
158 0.17
159 0.16
160 0.18
161 0.18
162 0.2
163 0.2
164 0.23
165 0.23
166 0.23
167 0.24
168 0.25
169 0.28
170 0.31
171 0.3
172 0.28
173 0.27
174 0.25
175 0.23
176 0.19
177 0.13
178 0.1
179 0.09
180 0.1
181 0.07
182 0.07
183 0.08
184 0.09
185 0.11
186 0.11
187 0.16
188 0.17
189 0.24
190 0.32
191 0.39
192 0.49
193 0.56
194 0.59
195 0.63
196 0.68
197 0.72
198 0.7
199 0.71
200 0.7
201 0.71
202 0.74
203 0.72
204 0.67
205 0.61
206 0.6
207 0.55
208 0.54
209 0.5
210 0.5
211 0.48
212 0.48
213 0.47
214 0.42
215 0.42
216 0.42
217 0.4
218 0.37
219 0.33
220 0.3
221 0.28
222 0.28
223 0.26
224 0.23
225 0.24
226 0.3
227 0.36
228 0.39
229 0.45
230 0.5
231 0.54
232 0.59
233 0.64
234 0.61
235 0.62
236 0.68
237 0.69
238 0.73
239 0.72
240 0.62
241 0.53
242 0.47
243 0.38
244 0.31
245 0.28
246 0.19
247 0.2
248 0.23
249 0.27
250 0.36