Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DCF3

Protein Details
Accession B0DCF3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
260-285EALLGKAKRVRTKRREVLFRVLTRRRHydrophilic
NLS Segment(s)
PositionSequence
262-285LLGKAKRVRTKRREVLFRVLTRRR
Subcellular Location(s) cyto 18.5, cyto_nucl 12.333, nucl 5, mito_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
KEGG lbc:LACBIDRAFT_298189  -  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MGMTGTGKSSFIKLLTGDEGVKVGETLEPETSEIKSFLFFHNHQCVSLVDTPGFDDSRPNMSDSKLLDDIAEFLKRRHHTKAVHGFMYFHRIRDVRVGGAATRNIRMFSSLCGPEAMKNVAIVTTRWDELHGEQQLQAAGKTEKELLGHHFEDFIDGQAQVHRHDNTLESAQAVMSSLLRCPPIGDIRVVVEILHGKTLPETDAGLELKEQLVQLVSHYEDELKRLSIEFQAAIKFNKEAHEEEVAKLRMELEKVKKDHEALLGKAKRVRTKRREVLFRVLTRRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.19
5 0.17
6 0.17
7 0.15
8 0.14
9 0.11
10 0.09
11 0.08
12 0.09
13 0.11
14 0.11
15 0.12
16 0.13
17 0.15
18 0.15
19 0.16
20 0.15
21 0.13
22 0.14
23 0.15
24 0.17
25 0.23
26 0.23
27 0.3
28 0.38
29 0.38
30 0.37
31 0.36
32 0.33
33 0.32
34 0.34
35 0.28
36 0.19
37 0.19
38 0.2
39 0.21
40 0.21
41 0.15
42 0.14
43 0.14
44 0.2
45 0.2
46 0.21
47 0.2
48 0.21
49 0.25
50 0.23
51 0.26
52 0.22
53 0.21
54 0.19
55 0.18
56 0.19
57 0.17
58 0.2
59 0.14
60 0.14
61 0.22
62 0.25
63 0.29
64 0.33
65 0.39
66 0.39
67 0.49
68 0.59
69 0.56
70 0.55
71 0.52
72 0.47
73 0.41
74 0.45
75 0.35
76 0.25
77 0.24
78 0.22
79 0.23
80 0.27
81 0.27
82 0.19
83 0.2
84 0.2
85 0.17
86 0.19
87 0.21
88 0.16
89 0.17
90 0.16
91 0.16
92 0.15
93 0.16
94 0.14
95 0.13
96 0.17
97 0.15
98 0.15
99 0.16
100 0.16
101 0.16
102 0.18
103 0.17
104 0.12
105 0.11
106 0.1
107 0.11
108 0.11
109 0.09
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.12
116 0.12
117 0.19
118 0.16
119 0.15
120 0.15
121 0.15
122 0.16
123 0.15
124 0.13
125 0.09
126 0.09
127 0.08
128 0.09
129 0.09
130 0.08
131 0.09
132 0.1
133 0.11
134 0.15
135 0.16
136 0.15
137 0.15
138 0.14
139 0.15
140 0.14
141 0.12
142 0.07
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.13
149 0.13
150 0.13
151 0.13
152 0.14
153 0.15
154 0.15
155 0.14
156 0.1
157 0.1
158 0.09
159 0.08
160 0.08
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.08
168 0.08
169 0.11
170 0.14
171 0.15
172 0.15
173 0.14
174 0.15
175 0.16
176 0.15
177 0.12
178 0.09
179 0.11
180 0.1
181 0.11
182 0.09
183 0.09
184 0.09
185 0.1
186 0.1
187 0.07
188 0.07
189 0.07
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.09
196 0.1
197 0.09
198 0.06
199 0.07
200 0.07
201 0.07
202 0.09
203 0.1
204 0.09
205 0.1
206 0.13
207 0.12
208 0.14
209 0.15
210 0.13
211 0.13
212 0.13
213 0.15
214 0.14
215 0.15
216 0.15
217 0.15
218 0.17
219 0.19
220 0.2
221 0.2
222 0.19
223 0.19
224 0.21
225 0.23
226 0.22
227 0.23
228 0.3
229 0.3
230 0.3
231 0.37
232 0.34
233 0.31
234 0.29
235 0.27
236 0.22
237 0.23
238 0.3
239 0.3
240 0.38
241 0.4
242 0.43
243 0.45
244 0.45
245 0.46
246 0.46
247 0.43
248 0.37
249 0.46
250 0.47
251 0.47
252 0.5
253 0.52
254 0.53
255 0.57
256 0.65
257 0.65
258 0.72
259 0.77
260 0.83
261 0.87
262 0.85
263 0.85
264 0.84
265 0.82
266 0.81