Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CZH9

Protein Details
Accession B0CZH9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-112ESYPKSKRRRVEHPSKRPVQPBasic
NLS Segment(s)
PositionSequence
98-102KRRRV
Subcellular Location(s) mito 13.5, cyto_mito 9.833, nucl 6.5, cyto_nucl 6.333, cyto 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_323221  -  
Amino Acid Sequences MATTWNTSSANVAAMAHLFCMKTSQLNGTVKFVNSNHRHSYRPDGRLGDGNRWVLSVPSTIPSTVPSTVPSTVLSTVPSTVPSTVPSTIPSESYPKSKRRRVEHPSKRPVQPSWTGTVRSPTLPYLACAPQPSELLSASWDTSQEPHSCGVPYLLRHRAWIFEVFIMPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.09
6 0.09
7 0.11
8 0.11
9 0.13
10 0.14
11 0.17
12 0.24
13 0.29
14 0.3
15 0.31
16 0.33
17 0.3
18 0.33
19 0.3
20 0.33
21 0.33
22 0.38
23 0.43
24 0.43
25 0.45
26 0.45
27 0.54
28 0.53
29 0.52
30 0.5
31 0.45
32 0.44
33 0.49
34 0.47
35 0.42
36 0.37
37 0.35
38 0.3
39 0.27
40 0.25
41 0.18
42 0.17
43 0.12
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.11
50 0.13
51 0.13
52 0.13
53 0.12
54 0.14
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.12
62 0.1
63 0.1
64 0.09
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09
70 0.11
71 0.11
72 0.11
73 0.11
74 0.13
75 0.13
76 0.14
77 0.13
78 0.15
79 0.16
80 0.23
81 0.27
82 0.34
83 0.42
84 0.47
85 0.54
86 0.57
87 0.66
88 0.68
89 0.74
90 0.77
91 0.79
92 0.82
93 0.82
94 0.8
95 0.74
96 0.67
97 0.61
98 0.57
99 0.49
100 0.45
101 0.41
102 0.38
103 0.34
104 0.36
105 0.32
106 0.26
107 0.25
108 0.2
109 0.2
110 0.18
111 0.18
112 0.18
113 0.19
114 0.19
115 0.19
116 0.19
117 0.18
118 0.19
119 0.19
120 0.16
121 0.15
122 0.13
123 0.13
124 0.13
125 0.12
126 0.12
127 0.11
128 0.1
129 0.12
130 0.15
131 0.16
132 0.16
133 0.17
134 0.18
135 0.18
136 0.18
137 0.2
138 0.2
139 0.23
140 0.29
141 0.34
142 0.33
143 0.37
144 0.37
145 0.37
146 0.36
147 0.35
148 0.3
149 0.25