Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TR69

Protein Details
Accession N4TR69    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
105-126ADNFAFKTTKKPHYKSWRCGPPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, pero 2
Family & Domain DBs
Amino Acid Sequences MHLSSLIPIITLSLGAANAMAIEEEGTLEARSDQCNPGINLIKLKIKPGKYFTGVGKPGKCYNLPANIKYFDVYSDDTKSLVSCFDCKVYTEVNCKGSYVSIEGADNFAFKTTKKPHYKSWRCGPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.07
17 0.08
18 0.09
19 0.12
20 0.13
21 0.14
22 0.18
23 0.18
24 0.23
25 0.26
26 0.25
27 0.26
28 0.27
29 0.3
30 0.27
31 0.32
32 0.33
33 0.32
34 0.35
35 0.37
36 0.39
37 0.36
38 0.39
39 0.36
40 0.38
41 0.39
42 0.39
43 0.36
44 0.34
45 0.33
46 0.32
47 0.3
48 0.25
49 0.24
50 0.3
51 0.31
52 0.29
53 0.3
54 0.29
55 0.29
56 0.26
57 0.22
58 0.14
59 0.14
60 0.14
61 0.13
62 0.15
63 0.14
64 0.14
65 0.14
66 0.14
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.12
73 0.13
74 0.14
75 0.16
76 0.17
77 0.2
78 0.25
79 0.28
80 0.3
81 0.29
82 0.28
83 0.27
84 0.24
85 0.22
86 0.18
87 0.14
88 0.12
89 0.13
90 0.13
91 0.14
92 0.13
93 0.12
94 0.1
95 0.1
96 0.1
97 0.09
98 0.19
99 0.25
100 0.36
101 0.46
102 0.51
103 0.6
104 0.71
105 0.81
106 0.81