Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DE86

Protein Details
Accession B0DE86    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-74SMKRNTKDLRLPRRSPNPHSPPNPDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002842  ATPase_V1_Esu  
Gene Ontology GO:0033178  C:proton-transporting two-sector ATPase complex, catalytic domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
KEGG lbc:LACBIDRAFT_298889  -  
Pfam View protein in Pfam  
PF01991  vATP-synt_E  
Amino Acid Sequences MNKMLSFIKQEALEKAREIWVKADKEFAIGKDKLEKQEKKQSRLSTPRLSMKRNTKDLRLPRRSPNPHSPPNPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.27
5 0.26
6 0.25
7 0.3
8 0.31
9 0.3
10 0.32
11 0.26
12 0.27
13 0.27
14 0.24
15 0.23
16 0.21
17 0.21
18 0.25
19 0.27
20 0.31
21 0.39
22 0.41
23 0.4
24 0.51
25 0.56
26 0.54
27 0.59
28 0.57
29 0.58
30 0.63
31 0.64
32 0.61
33 0.6
34 0.64
35 0.63
36 0.61
37 0.6
38 0.62
39 0.63
40 0.65
41 0.63
42 0.6
43 0.65
44 0.71
45 0.74
46 0.73
47 0.7
48 0.71
49 0.78
50 0.81
51 0.8
52 0.8
53 0.79
54 0.79