Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4TGV0

Protein Details
Accession N4TGV0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-103ISILQRENKENRPKRRKKVIYNPNAKFAKHydrophilic
NLS Segment(s)
PositionSequence
83-112KENRPKRRKKVIYNPNAKFAKIPAIKKAHK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences IVTETPSPAVTANLPAKEQHSSLLKTPQSSIQLRRALDLVPASATQDPTIRLLFRKISSQLDRHNFNIKQQNRQISILQRENKENRPKRRKKVIYNPNAKFAKIPAIKKAHKQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.27
5 0.26
6 0.23
7 0.24
8 0.25
9 0.27
10 0.35
11 0.34
12 0.33
13 0.34
14 0.34
15 0.35
16 0.37
17 0.38
18 0.38
19 0.41
20 0.4
21 0.4
22 0.36
23 0.3
24 0.27
25 0.23
26 0.15
27 0.11
28 0.11
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.12
37 0.11
38 0.11
39 0.13
40 0.15
41 0.15
42 0.17
43 0.18
44 0.22
45 0.25
46 0.28
47 0.33
48 0.35
49 0.37
50 0.36
51 0.42
52 0.37
53 0.39
54 0.46
55 0.41
56 0.45
57 0.47
58 0.52
59 0.47
60 0.49
61 0.46
62 0.44
63 0.49
64 0.48
65 0.49
66 0.45
67 0.49
68 0.52
69 0.58
70 0.62
71 0.63
72 0.66
73 0.72
74 0.8
75 0.83
76 0.89
77 0.9
78 0.9
79 0.92
80 0.92
81 0.91
82 0.92
83 0.85
84 0.83
85 0.75
86 0.64
87 0.54
88 0.45
89 0.45
90 0.41
91 0.41
92 0.41
93 0.49
94 0.53