Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UUI4

Protein Details
Accession N4UUI4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-129GTNNEAQKPRRRRREESEDFTHydrophilic
NLS Segment(s)
PositionSequence
118-120RRR
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MMSCTCRATPLKIFVQGLSQVHKVDASPSLLRLPIRTRPALYQNNFASARQARSWHFSKALQDASGQAARDDDPFSHIRSEDENRAVKNDDTFATDESPESIPWKAQPGTNNEAQKPRRRRREESEDFTTLNYRRNQSVRQQLEDDNEANEYNGNPNRRMKGPSSLQPQPKESYWKIQKAALKEKFPEGWRPRKRLSPDALAGIRALNAQFPDVYTTEALSNKFEVSPEAIRRILRSKWQANPEEEEKRNARWLRRGKDVWEQKAALGIKPPQKWRREGITRDPSYHDWKKEAVERNRVREERDDMEIRGDYTPRPRTYTPRSRIPRTGEYTPRSVSRTGRGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.43
4 0.38
5 0.35
6 0.32
7 0.27
8 0.26
9 0.26
10 0.21
11 0.19
12 0.2
13 0.2
14 0.19
15 0.2
16 0.22
17 0.24
18 0.25
19 0.26
20 0.28
21 0.31
22 0.36
23 0.38
24 0.39
25 0.42
26 0.51
27 0.57
28 0.55
29 0.56
30 0.51
31 0.54
32 0.53
33 0.47
34 0.44
35 0.38
36 0.4
37 0.34
38 0.37
39 0.32
40 0.38
41 0.41
42 0.39
43 0.38
44 0.37
45 0.38
46 0.4
47 0.4
48 0.33
49 0.31
50 0.28
51 0.29
52 0.28
53 0.23
54 0.17
55 0.16
56 0.16
57 0.17
58 0.17
59 0.12
60 0.14
61 0.16
62 0.18
63 0.19
64 0.18
65 0.18
66 0.22
67 0.27
68 0.28
69 0.33
70 0.35
71 0.33
72 0.36
73 0.37
74 0.32
75 0.29
76 0.25
77 0.19
78 0.19
79 0.2
80 0.19
81 0.18
82 0.17
83 0.15
84 0.15
85 0.15
86 0.13
87 0.13
88 0.12
89 0.11
90 0.12
91 0.17
92 0.16
93 0.18
94 0.23
95 0.27
96 0.32
97 0.37
98 0.4
99 0.38
100 0.45
101 0.48
102 0.53
103 0.58
104 0.63
105 0.68
106 0.71
107 0.76
108 0.77
109 0.83
110 0.83
111 0.79
112 0.76
113 0.68
114 0.6
115 0.53
116 0.48
117 0.38
118 0.34
119 0.31
120 0.26
121 0.27
122 0.3
123 0.34
124 0.37
125 0.46
126 0.43
127 0.42
128 0.43
129 0.41
130 0.41
131 0.39
132 0.32
133 0.22
134 0.19
135 0.16
136 0.13
137 0.11
138 0.09
139 0.11
140 0.14
141 0.15
142 0.18
143 0.21
144 0.24
145 0.26
146 0.29
147 0.27
148 0.31
149 0.33
150 0.37
151 0.4
152 0.45
153 0.48
154 0.47
155 0.47
156 0.42
157 0.39
158 0.39
159 0.34
160 0.37
161 0.38
162 0.4
163 0.39
164 0.41
165 0.42
166 0.41
167 0.5
168 0.46
169 0.42
170 0.38
171 0.39
172 0.39
173 0.38
174 0.42
175 0.39
176 0.44
177 0.49
178 0.54
179 0.55
180 0.58
181 0.62
182 0.59
183 0.57
184 0.53
185 0.48
186 0.47
187 0.44
188 0.37
189 0.32
190 0.24
191 0.19
192 0.13
193 0.11
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.08
200 0.08
201 0.1
202 0.09
203 0.09
204 0.11
205 0.13
206 0.13
207 0.12
208 0.12
209 0.12
210 0.12
211 0.11
212 0.1
213 0.12
214 0.16
215 0.18
216 0.2
217 0.22
218 0.22
219 0.24
220 0.28
221 0.27
222 0.3
223 0.36
224 0.39
225 0.44
226 0.52
227 0.55
228 0.54
229 0.57
230 0.56
231 0.56
232 0.51
233 0.5
234 0.44
235 0.41
236 0.46
237 0.45
238 0.44
239 0.45
240 0.53
241 0.52
242 0.6
243 0.6
244 0.56
245 0.62
246 0.66
247 0.62
248 0.59
249 0.54
250 0.44
251 0.48
252 0.44
253 0.35
254 0.31
255 0.32
256 0.33
257 0.38
258 0.48
259 0.49
260 0.54
261 0.58
262 0.59
263 0.63
264 0.65
265 0.66
266 0.68
267 0.7
268 0.68
269 0.66
270 0.65
271 0.59
272 0.59
273 0.59
274 0.52
275 0.44
276 0.43
277 0.45
278 0.49
279 0.54
280 0.54
281 0.57
282 0.61
283 0.67
284 0.74
285 0.71
286 0.67
287 0.63
288 0.61
289 0.53
290 0.53
291 0.48
292 0.38
293 0.41
294 0.37
295 0.33
296 0.29
297 0.26
298 0.22
299 0.28
300 0.36
301 0.35
302 0.41
303 0.43
304 0.49
305 0.59
306 0.66
307 0.65
308 0.67
309 0.73
310 0.74
311 0.79
312 0.78
313 0.77
314 0.73
315 0.75
316 0.74
317 0.7
318 0.68
319 0.64
320 0.6
321 0.54
322 0.5
323 0.46
324 0.46