Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DDH0

Protein Details
Accession B0DDH0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRQREEHPQRPQRVRRTSIHBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_298716  -  
Amino Acid Sequences MRQREEHPQRPQRVRRTSIHRGEPWRSGREAGREGSRSNDEACNVDRQREASLGRTMSCPDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.79
5 0.76
6 0.76
7 0.71
8 0.69
9 0.66
10 0.66
11 0.61
12 0.54
13 0.47
14 0.41
15 0.37
16 0.35
17 0.33
18 0.27
19 0.26
20 0.24
21 0.24
22 0.25
23 0.24
24 0.21
25 0.2
26 0.2
27 0.17
28 0.18
29 0.19
30 0.25
31 0.24
32 0.25
33 0.24
34 0.24
35 0.26
36 0.27
37 0.27
38 0.22
39 0.27
40 0.26
41 0.26
42 0.27
43 0.27