Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UKZ6

Protein Details
Accession N4UKZ6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
267-302RSTLGERRRRDEFRRRENDRRERKYEFQKQLREEMSBasic
NLS Segment(s)
PositionSequence
273-289RRRRDEFRRRENDRRER
Subcellular Location(s) nucl 13.5, cyto_nucl 9.333, mito 8.5, cyto_mito 6.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MSAIRGFLNAFKARSPPITGIINLKPLSDSNARVGSAFIERCNPFRDIPKDARLENTLCEVRYIDRVLRDTLVPTSLPGDDYHFCSKLLRSLETRRDLTWLVLRETDIRDTIGAIARRGGRRAPIPDEPHDIHSRAKALERHWSALEKCHTKLREWEPKYATQSQPPLLEEEEAYVLELSDEQAAHAEIEYREWRSDRDRKVSYLKLNPPEPAAFIPVERRHIQTDETWKILPPSGSEIGMRLLPVWTPIIFQEVPLDWESPDSSLRSTLGERRRRDEFRRRENDRRERKYEFQKQLREEMSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.3
4 0.31
5 0.33
6 0.32
7 0.35
8 0.35
9 0.38
10 0.34
11 0.32
12 0.28
13 0.25
14 0.29
15 0.27
16 0.27
17 0.25
18 0.29
19 0.28
20 0.27
21 0.27
22 0.23
23 0.25
24 0.24
25 0.2
26 0.24
27 0.25
28 0.27
29 0.3
30 0.31
31 0.27
32 0.35
33 0.39
34 0.39
35 0.44
36 0.5
37 0.5
38 0.49
39 0.5
40 0.45
41 0.42
42 0.35
43 0.36
44 0.3
45 0.26
46 0.26
47 0.23
48 0.2
49 0.23
50 0.24
51 0.2
52 0.21
53 0.23
54 0.24
55 0.25
56 0.24
57 0.21
58 0.2
59 0.19
60 0.15
61 0.13
62 0.13
63 0.12
64 0.12
65 0.11
66 0.14
67 0.14
68 0.19
69 0.22
70 0.21
71 0.21
72 0.22
73 0.22
74 0.23
75 0.25
76 0.23
77 0.24
78 0.32
79 0.4
80 0.44
81 0.45
82 0.4
83 0.4
84 0.38
85 0.35
86 0.32
87 0.26
88 0.22
89 0.21
90 0.21
91 0.21
92 0.22
93 0.21
94 0.16
95 0.14
96 0.12
97 0.12
98 0.12
99 0.14
100 0.13
101 0.12
102 0.15
103 0.19
104 0.2
105 0.21
106 0.2
107 0.19
108 0.23
109 0.27
110 0.28
111 0.31
112 0.35
113 0.36
114 0.41
115 0.39
116 0.39
117 0.37
118 0.33
119 0.28
120 0.25
121 0.23
122 0.18
123 0.21
124 0.2
125 0.19
126 0.27
127 0.28
128 0.28
129 0.27
130 0.3
131 0.26
132 0.29
133 0.33
134 0.27
135 0.26
136 0.3
137 0.3
138 0.28
139 0.35
140 0.38
141 0.43
142 0.43
143 0.49
144 0.46
145 0.5
146 0.53
147 0.51
148 0.44
149 0.38
150 0.39
151 0.34
152 0.33
153 0.29
154 0.25
155 0.2
156 0.19
157 0.14
158 0.12
159 0.1
160 0.08
161 0.08
162 0.06
163 0.05
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.05
173 0.05
174 0.07
175 0.06
176 0.09
177 0.11
178 0.12
179 0.13
180 0.14
181 0.16
182 0.23
183 0.31
184 0.35
185 0.42
186 0.43
187 0.46
188 0.52
189 0.56
190 0.55
191 0.56
192 0.57
193 0.55
194 0.55
195 0.51
196 0.47
197 0.41
198 0.35
199 0.27
200 0.23
201 0.16
202 0.15
203 0.21
204 0.21
205 0.26
206 0.26
207 0.28
208 0.28
209 0.29
210 0.3
211 0.29
212 0.36
213 0.34
214 0.35
215 0.33
216 0.3
217 0.3
218 0.31
219 0.26
220 0.18
221 0.2
222 0.19
223 0.2
224 0.19
225 0.19
226 0.17
227 0.17
228 0.16
229 0.1
230 0.09
231 0.08
232 0.09
233 0.1
234 0.09
235 0.09
236 0.1
237 0.15
238 0.14
239 0.14
240 0.16
241 0.15
242 0.18
243 0.19
244 0.19
245 0.13
246 0.15
247 0.16
248 0.14
249 0.15
250 0.14
251 0.13
252 0.14
253 0.15
254 0.15
255 0.18
256 0.25
257 0.33
258 0.41
259 0.44
260 0.48
261 0.57
262 0.62
263 0.69
264 0.71
265 0.72
266 0.75
267 0.81
268 0.85
269 0.87
270 0.9
271 0.91
272 0.91
273 0.9
274 0.86
275 0.84
276 0.84
277 0.85
278 0.84
279 0.84
280 0.83
281 0.83
282 0.8
283 0.81
284 0.78