Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TSE5

Protein Details
Accession N4TSE5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
263-295IPVKKVYRDIWERKHPPRRWRAPRLERPKTSLDBasic
NLS Segment(s)
PositionSequence
275-289RKHPPRRWRAPRLER
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, pero 7
Family & Domain DBs
Amino Acid Sequences MAIPEYVPLDQLEGVHFELLSRAVRNVLDTDIALITYAQIIDGLPVTDVAWDYHKELCPGALEKAKVFRTNFAMADVKIDLEKLNRYQETKPPSRSFYLRLIEVTVCALHQIGVRLSQQEKFHDPATTAGHDVESTTNWERPLDHLCRVTPSPTMFIATQFTAHNRYPNGIDDIVGYWAENRILGGVALFDHSQAWTGDNEPNVYFQCTRERVTFRVCQLIDAQQSALISFLLADTEDAIAKCPLPILPTSENRVRIDPGDAIPVKKVYRDIWERKHPPRRWRAPRLERPKTSLDYPELNTDAEVERLNRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.1
5 0.11
6 0.12
7 0.14
8 0.12
9 0.12
10 0.14
11 0.15
12 0.17
13 0.17
14 0.16
15 0.15
16 0.14
17 0.15
18 0.13
19 0.13
20 0.11
21 0.09
22 0.08
23 0.07
24 0.07
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08
37 0.1
38 0.11
39 0.13
40 0.18
41 0.19
42 0.2
43 0.19
44 0.19
45 0.2
46 0.21
47 0.23
48 0.23
49 0.22
50 0.23
51 0.29
52 0.32
53 0.34
54 0.33
55 0.33
56 0.33
57 0.36
58 0.34
59 0.32
60 0.31
61 0.25
62 0.27
63 0.23
64 0.18
65 0.14
66 0.14
67 0.11
68 0.11
69 0.14
70 0.15
71 0.21
72 0.23
73 0.27
74 0.3
75 0.35
76 0.42
77 0.46
78 0.51
79 0.49
80 0.51
81 0.52
82 0.51
83 0.49
84 0.48
85 0.44
86 0.37
87 0.33
88 0.31
89 0.27
90 0.24
91 0.2
92 0.12
93 0.09
94 0.08
95 0.07
96 0.06
97 0.07
98 0.08
99 0.08
100 0.1
101 0.11
102 0.13
103 0.15
104 0.18
105 0.19
106 0.21
107 0.24
108 0.24
109 0.24
110 0.22
111 0.21
112 0.2
113 0.21
114 0.19
115 0.16
116 0.14
117 0.13
118 0.12
119 0.12
120 0.1
121 0.07
122 0.1
123 0.11
124 0.13
125 0.13
126 0.13
127 0.13
128 0.15
129 0.21
130 0.2
131 0.21
132 0.21
133 0.21
134 0.24
135 0.24
136 0.23
137 0.19
138 0.17
139 0.16
140 0.15
141 0.16
142 0.13
143 0.13
144 0.13
145 0.11
146 0.11
147 0.1
148 0.11
149 0.14
150 0.14
151 0.16
152 0.15
153 0.16
154 0.16
155 0.17
156 0.19
157 0.15
158 0.14
159 0.12
160 0.12
161 0.12
162 0.1
163 0.09
164 0.06
165 0.06
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.04
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.06
182 0.07
183 0.07
184 0.09
185 0.11
186 0.12
187 0.13
188 0.12
189 0.14
190 0.13
191 0.16
192 0.14
193 0.14
194 0.21
195 0.22
196 0.25
197 0.29
198 0.32
199 0.32
200 0.37
201 0.4
202 0.35
203 0.4
204 0.38
205 0.33
206 0.32
207 0.34
208 0.3
209 0.26
210 0.24
211 0.16
212 0.16
213 0.15
214 0.13
215 0.07
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.06
225 0.06
226 0.08
227 0.09
228 0.09
229 0.09
230 0.09
231 0.09
232 0.09
233 0.11
234 0.15
235 0.21
236 0.25
237 0.31
238 0.35
239 0.4
240 0.4
241 0.42
242 0.37
243 0.33
244 0.32
245 0.29
246 0.25
247 0.28
248 0.28
249 0.26
250 0.27
251 0.29
252 0.27
253 0.26
254 0.28
255 0.22
256 0.3
257 0.39
258 0.46
259 0.52
260 0.62
261 0.69
262 0.77
263 0.85
264 0.84
265 0.84
266 0.86
267 0.88
268 0.88
269 0.9
270 0.91
271 0.91
272 0.94
273 0.95
274 0.94
275 0.88
276 0.83
277 0.8
278 0.74
279 0.67
280 0.62
281 0.57
282 0.52
283 0.49
284 0.49
285 0.43
286 0.38
287 0.33
288 0.29
289 0.25
290 0.21
291 0.2