Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UF74

Protein Details
Accession N4UF74   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
152-181VGGRSGKTRTKMQKAKKKQSRGFKGWSYCYHydrophilic
NLS Segment(s)
PositionSequence
155-173RSGKTRTKMQKAKKKQSRG
Subcellular Location(s) mito 13, plas 6, E.R. 5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000454  ATP_synth_F0_csu  
IPR020537  ATP_synth_F0_csu_DDCD_BS  
IPR038662  ATP_synth_F0_csu_sf  
IPR002379  ATPase_proteolipid_c-like_dom  
IPR035921  F/V-ATP_Csub_sf  
Gene Ontology GO:0045263  C:proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0008289  F:lipid binding  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF00137  ATP-synt_C  
PROSITE View protein in PROSITE  
PS00605  ATPASE_C  
CDD cd18182  ATP-synt_Fo_c_ATP5G3  
Amino Acid Sequences MASSRVFASRLASQMAVKAARPAVRAPVAAASKRTISGASPLQAMKRQTLLQATSRNAFQVQRRAYSSEIAQAMVEVSKNLGMGAAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFEMERNWVGGRSGKTRTKMQKAKKKQSRGFKGWSYCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.23
4 0.2
5 0.21
6 0.23
7 0.24
8 0.26
9 0.25
10 0.26
11 0.28
12 0.27
13 0.25
14 0.28
15 0.29
16 0.29
17 0.3
18 0.25
19 0.24
20 0.24
21 0.24
22 0.18
23 0.14
24 0.18
25 0.19
26 0.18
27 0.2
28 0.2
29 0.22
30 0.25
31 0.26
32 0.23
33 0.22
34 0.21
35 0.21
36 0.24
37 0.25
38 0.26
39 0.3
40 0.3
41 0.29
42 0.28
43 0.27
44 0.25
45 0.25
46 0.24
47 0.28
48 0.28
49 0.3
50 0.31
51 0.33
52 0.32
53 0.31
54 0.27
55 0.23
56 0.21
57 0.18
58 0.15
59 0.13
60 0.12
61 0.1
62 0.1
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.01
81 0.01
82 0.01
83 0.01
84 0.01
85 0.01
86 0.01
87 0.01
88 0.01
89 0.01
90 0.01
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.03
97 0.03
98 0.04
99 0.07
100 0.1
101 0.1
102 0.12
103 0.13
104 0.17
105 0.17
106 0.17
107 0.15
108 0.13
109 0.13
110 0.11
111 0.09
112 0.05
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.06
134 0.09
135 0.1
136 0.12
137 0.14
138 0.15
139 0.16
140 0.21
141 0.24
142 0.27
143 0.34
144 0.37
145 0.4
146 0.49
147 0.57
148 0.63
149 0.69
150 0.74
151 0.78
152 0.83
153 0.9
154 0.91
155 0.92
156 0.9
157 0.91
158 0.91
159 0.88
160 0.85
161 0.83