Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DFP9

Protein Details
Accession B0DFP9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-93RVDFKIWHRSQSKKKGKKRNLVASSTHHydrophilic
NLS Segment(s)
PositionSequence
78-85SKKKGKKR
Subcellular Location(s) plas 22, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG lbc:LACBIDRAFT_299945  -  
Pfam View protein in Pfam  
PF00168  C2  
PROSITE View protein in PROSITE  
PS50004  C2  
CDD cd00030  C2  
Amino Acid Sequences MERKEPWQLTVIRTQGLRLMRPEKSWRPIVTVEVDKHDSHETVLGVDGQNPNLKETFRFHQADMSSRVDFKIWHRSQSKKKGKKRNLVASSTHSLGELLKKQETEPRLEIRLHCQSASNRAISSRGKPQNGALMHLRVRPPMAPLTSPPLLCPSDTGYSSDASSSSRASSTLIPPSPIDDEPKPPQPSILRRRRVRGYALGSDEEVFSSDGEEIEERKPLPLFSDPEDFPQQTYWNSSDDDSPRNQPSHPKSSWGWISASLLPKYTEKIEVLEPRPLSLTGRVLASFTMYSELKEATMDSEYDKVFARLQMEWTYMGGLLVALAAVDTAVFSISPDSLFGVNSYARSAIATSSITSGLGIACDAWFLLRYNWADLQTFIARARDVYGSYFFFSLSARVPGLCMFISALSLMLFLGLVAFDAWPEGVIAVCFMVGVVMSLQFLVYGAHWCVGRVVEGGRTGIRAVRRVTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.35
4 0.34
5 0.34
6 0.38
7 0.38
8 0.44
9 0.53
10 0.56
11 0.59
12 0.63
13 0.57
14 0.56
15 0.55
16 0.53
17 0.51
18 0.5
19 0.46
20 0.44
21 0.45
22 0.39
23 0.4
24 0.38
25 0.32
26 0.25
27 0.25
28 0.19
29 0.16
30 0.17
31 0.17
32 0.14
33 0.18
34 0.19
35 0.18
36 0.22
37 0.22
38 0.23
39 0.23
40 0.23
41 0.22
42 0.25
43 0.29
44 0.33
45 0.35
46 0.33
47 0.38
48 0.39
49 0.42
50 0.42
51 0.41
52 0.34
53 0.32
54 0.32
55 0.27
56 0.27
57 0.26
58 0.32
59 0.3
60 0.37
61 0.42
62 0.52
63 0.61
64 0.7
65 0.77
66 0.76
67 0.84
68 0.87
69 0.91
70 0.92
71 0.92
72 0.91
73 0.88
74 0.84
75 0.78
76 0.74
77 0.68
78 0.58
79 0.48
80 0.37
81 0.29
82 0.24
83 0.26
84 0.24
85 0.23
86 0.24
87 0.24
88 0.25
89 0.32
90 0.33
91 0.34
92 0.33
93 0.34
94 0.36
95 0.38
96 0.39
97 0.4
98 0.46
99 0.4
100 0.36
101 0.36
102 0.35
103 0.4
104 0.42
105 0.36
106 0.28
107 0.27
108 0.32
109 0.3
110 0.32
111 0.34
112 0.38
113 0.38
114 0.39
115 0.4
116 0.42
117 0.4
118 0.39
119 0.32
120 0.29
121 0.3
122 0.33
123 0.32
124 0.26
125 0.26
126 0.23
127 0.23
128 0.22
129 0.22
130 0.19
131 0.19
132 0.25
133 0.26
134 0.26
135 0.23
136 0.23
137 0.22
138 0.21
139 0.2
140 0.18
141 0.18
142 0.19
143 0.2
144 0.16
145 0.16
146 0.17
147 0.16
148 0.12
149 0.1
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.13
157 0.15
158 0.2
159 0.2
160 0.2
161 0.2
162 0.22
163 0.23
164 0.21
165 0.22
166 0.18
167 0.23
168 0.26
169 0.34
170 0.34
171 0.31
172 0.34
173 0.35
174 0.44
175 0.49
176 0.55
177 0.57
178 0.59
179 0.65
180 0.68
181 0.66
182 0.6
183 0.57
184 0.52
185 0.48
186 0.46
187 0.4
188 0.35
189 0.31
190 0.26
191 0.18
192 0.14
193 0.09
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.06
200 0.07
201 0.07
202 0.09
203 0.09
204 0.1
205 0.1
206 0.1
207 0.12
208 0.14
209 0.15
210 0.16
211 0.21
212 0.2
213 0.24
214 0.27
215 0.24
216 0.21
217 0.2
218 0.18
219 0.14
220 0.16
221 0.14
222 0.12
223 0.13
224 0.13
225 0.16
226 0.17
227 0.2
228 0.19
229 0.22
230 0.23
231 0.23
232 0.23
233 0.28
234 0.32
235 0.38
236 0.36
237 0.36
238 0.34
239 0.39
240 0.41
241 0.34
242 0.28
243 0.21
244 0.23
245 0.23
246 0.26
247 0.2
248 0.19
249 0.18
250 0.18
251 0.18
252 0.17
253 0.15
254 0.12
255 0.14
256 0.17
257 0.23
258 0.24
259 0.28
260 0.26
261 0.25
262 0.25
263 0.24
264 0.2
265 0.16
266 0.16
267 0.12
268 0.13
269 0.12
270 0.11
271 0.11
272 0.11
273 0.09
274 0.07
275 0.09
276 0.08
277 0.09
278 0.09
279 0.1
280 0.09
281 0.09
282 0.09
283 0.07
284 0.08
285 0.08
286 0.08
287 0.11
288 0.11
289 0.12
290 0.12
291 0.12
292 0.12
293 0.13
294 0.14
295 0.12
296 0.15
297 0.16
298 0.17
299 0.16
300 0.15
301 0.14
302 0.12
303 0.11
304 0.08
305 0.05
306 0.04
307 0.03
308 0.03
309 0.02
310 0.02
311 0.02
312 0.02
313 0.02
314 0.02
315 0.02
316 0.02
317 0.02
318 0.03
319 0.04
320 0.04
321 0.04
322 0.05
323 0.06
324 0.07
325 0.07
326 0.07
327 0.09
328 0.09
329 0.1
330 0.1
331 0.09
332 0.09
333 0.09
334 0.09
335 0.07
336 0.09
337 0.09
338 0.09
339 0.1
340 0.1
341 0.1
342 0.09
343 0.09
344 0.07
345 0.06
346 0.06
347 0.05
348 0.04
349 0.04
350 0.04
351 0.04
352 0.05
353 0.06
354 0.07
355 0.12
356 0.14
357 0.17
358 0.2
359 0.21
360 0.21
361 0.2
362 0.24
363 0.2
364 0.21
365 0.19
366 0.18
367 0.16
368 0.16
369 0.18
370 0.15
371 0.14
372 0.15
373 0.18
374 0.18
375 0.19
376 0.19
377 0.16
378 0.15
379 0.14
380 0.14
381 0.12
382 0.13
383 0.12
384 0.12
385 0.13
386 0.13
387 0.15
388 0.13
389 0.12
390 0.1
391 0.09
392 0.1
393 0.09
394 0.09
395 0.06
396 0.06
397 0.05
398 0.05
399 0.04
400 0.04
401 0.04
402 0.03
403 0.03
404 0.04
405 0.04
406 0.04
407 0.04
408 0.04
409 0.04
410 0.05
411 0.05
412 0.05
413 0.05
414 0.05
415 0.05
416 0.05
417 0.04
418 0.04
419 0.04
420 0.03
421 0.04
422 0.04
423 0.04
424 0.05
425 0.05
426 0.05
427 0.05
428 0.05
429 0.05
430 0.06
431 0.09
432 0.1
433 0.12
434 0.13
435 0.13
436 0.14
437 0.14
438 0.15
439 0.14
440 0.14
441 0.15
442 0.17
443 0.19
444 0.18
445 0.19
446 0.18
447 0.2
448 0.23
449 0.25