Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UWT8

Protein Details
Accession N4UWT8   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKSARASTRKANNRRLVKNVFHydrophilic
78-109VDSKKPSSGRIEKKRVDKRKQKASKIVFKSYGHydrophilic
NLS Segment(s)
PositionSequence
81-119KKPSSGRIEKKRVDKRKQKASKIVFKSYGGRSKGKKKSS
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASTRKANNRRLVKNVFGPAEAARNERLSAKLLELAKQPKPESSDVNMNTQEEGANDDAKEDVQDNEVTSMDVDSKKPSSGRIEKKRVDKRKQKASKIVFKSYGGRSKGKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.76
5 0.71
6 0.68
7 0.64
8 0.56
9 0.46
10 0.41
11 0.34
12 0.33
13 0.28
14 0.23
15 0.19
16 0.19
17 0.19
18 0.19
19 0.19
20 0.17
21 0.17
22 0.16
23 0.19
24 0.18
25 0.2
26 0.24
27 0.27
28 0.28
29 0.31
30 0.31
31 0.28
32 0.31
33 0.31
34 0.3
35 0.28
36 0.33
37 0.3
38 0.34
39 0.32
40 0.29
41 0.27
42 0.23
43 0.19
44 0.11
45 0.11
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.11
67 0.12
68 0.14
69 0.14
70 0.17
71 0.24
72 0.33
73 0.43
74 0.51
75 0.6
76 0.64
77 0.75
78 0.82
79 0.84
80 0.85
81 0.85
82 0.84
83 0.86
84 0.9
85 0.88
86 0.88
87 0.88
88 0.87
89 0.84
90 0.83
91 0.75
92 0.68
93 0.66
94 0.63
95 0.62
96 0.56
97 0.56
98 0.56
99 0.63