Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4U8F2

Protein Details
Accession N4U8F2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
136-165KDDAEKESAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
103-157AAIGGRKRKVGKVIGEAADEAKDEGKGEDKKKEKDDAEKESAKNRKPKKKAKKIK
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKINSKNLSYDTEAAAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLEVDKDGVVKDTGDYDVEPAAEKETAKESESKAAIGGRKRKVGKVIGEAADEAKDEGKGEDKKKEKDDAEKESAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.23
5 0.18
6 0.13
7 0.12
8 0.09
9 0.07
10 0.06
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.08
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.11
26 0.13
27 0.14
28 0.18
29 0.27
30 0.34
31 0.39
32 0.46
33 0.47
34 0.53
35 0.6
36 0.62
37 0.61
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.36
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.1
82 0.11
83 0.11
84 0.14
85 0.14
86 0.18
87 0.19
88 0.18
89 0.16
90 0.17
91 0.2
92 0.24
93 0.31
94 0.3
95 0.37
96 0.39
97 0.41
98 0.44
99 0.46
100 0.44
101 0.43
102 0.45
103 0.39
104 0.37
105 0.35
106 0.3
107 0.24
108 0.2
109 0.14
110 0.09
111 0.07
112 0.07
113 0.07
114 0.14
115 0.2
116 0.23
117 0.32
118 0.39
119 0.45
120 0.49
121 0.57
122 0.54
123 0.58
124 0.63
125 0.62
126 0.63
127 0.64
128 0.61
129 0.62
130 0.66
131 0.63
132 0.64
133 0.66
134 0.69
135 0.73
136 0.82
137 0.85
138 0.88
139 0.92
140 0.94
141 0.95
142 0.94
143 0.95
144 0.93
145 0.9