Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CUT5

Protein Details
Accession B0CUT5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-117LKDHKQQQKDREKKVSKFEQBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13.333, cyto 10, mito_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
KEGG lbc:LACBIDRAFT_176793  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSDREGHSGLPPTDEDLSLPKATVAKMIAELLPSDVVCAKETRDLVIECCVEFIHLISSEANEICEQESKKTIAPEHIINALKRLGFDSFTSEVEDVLKDHKQQQKDREKKVSKFEQSGMTEEELLAKQEELFAASRAKFQSTQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.17
4 0.21
5 0.19
6 0.18
7 0.16
8 0.16
9 0.16
10 0.18
11 0.16
12 0.12
13 0.13
14 0.15
15 0.14
16 0.12
17 0.13
18 0.11
19 0.11
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.11
27 0.14
28 0.15
29 0.15
30 0.16
31 0.16
32 0.16
33 0.2
34 0.19
35 0.15
36 0.15
37 0.13
38 0.11
39 0.1
40 0.09
41 0.07
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.1
53 0.1
54 0.11
55 0.13
56 0.13
57 0.15
58 0.16
59 0.16
60 0.16
61 0.18
62 0.18
63 0.17
64 0.21
65 0.21
66 0.2
67 0.2
68 0.19
69 0.16
70 0.16
71 0.15
72 0.11
73 0.1
74 0.1
75 0.14
76 0.14
77 0.15
78 0.16
79 0.15
80 0.14
81 0.14
82 0.13
83 0.09
84 0.1
85 0.12
86 0.12
87 0.19
88 0.25
89 0.31
90 0.38
91 0.48
92 0.56
93 0.64
94 0.71
95 0.75
96 0.78
97 0.77
98 0.8
99 0.8
100 0.75
101 0.71
102 0.65
103 0.63
104 0.56
105 0.53
106 0.46
107 0.37
108 0.3
109 0.26
110 0.25
111 0.17
112 0.16
113 0.14
114 0.11
115 0.1
116 0.11
117 0.11
118 0.1
119 0.11
120 0.11
121 0.16
122 0.16
123 0.21
124 0.21
125 0.25