Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UNJ2

Protein Details
Accession N4UNJ2   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-69ASVKSQGAYKKKPKRGIPKKLGAKRTGHydrophilic
202-237AKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAEBasic
248-268KAVKMLSQKQAKKAKKASKKKHydrophilic
NLS Segment(s)
PositionSequence
51-67YKKKPKRGIPKKLGAKR
206-268GLKTKRFRTRKQWFRHRRWRRERELEGQRKAEQKRAESGGEIKAVKMLSQKQAKKAKKASKKK
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MRFLTMQRPILAAVASLARPAFTPVTPLGVQLANSLVQGHRFASVKSQGAYKKKPKRGIPKKLGAKRTGDQFVIPGNILYKQRGTHWWPGENCIMGRDHTIHAMATGYVKYYRDPSLHPDRKYIGVVFDKNDTLPYPAHAQRKRKLNMTAFPIKEVAAQPEISPSGIPFQVNRVEAGEPDRLLKLRKDYSYREDNWAIGKLAKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAEQKRAESGGEIKAVKMLSQKQAKKAKKASKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.1
6 0.1
7 0.14
8 0.15
9 0.12
10 0.16
11 0.15
12 0.21
13 0.21
14 0.21
15 0.2
16 0.19
17 0.19
18 0.16
19 0.16
20 0.11
21 0.11
22 0.12
23 0.1
24 0.11
25 0.12
26 0.12
27 0.14
28 0.14
29 0.14
30 0.2
31 0.25
32 0.26
33 0.26
34 0.31
35 0.35
36 0.43
37 0.52
38 0.56
39 0.61
40 0.67
41 0.75
42 0.78
43 0.83
44 0.86
45 0.87
46 0.87
47 0.87
48 0.88
49 0.88
50 0.86
51 0.8
52 0.75
53 0.67
54 0.65
55 0.58
56 0.48
57 0.4
58 0.33
59 0.3
60 0.25
61 0.21
62 0.14
63 0.11
64 0.14
65 0.15
66 0.15
67 0.15
68 0.15
69 0.17
70 0.23
71 0.28
72 0.33
73 0.36
74 0.41
75 0.4
76 0.43
77 0.43
78 0.38
79 0.32
80 0.25
81 0.21
82 0.15
83 0.16
84 0.14
85 0.13
86 0.12
87 0.13
88 0.11
89 0.1
90 0.1
91 0.08
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.11
99 0.13
100 0.14
101 0.15
102 0.21
103 0.31
104 0.38
105 0.39
106 0.39
107 0.38
108 0.38
109 0.38
110 0.32
111 0.25
112 0.22
113 0.22
114 0.2
115 0.2
116 0.18
117 0.17
118 0.17
119 0.13
120 0.11
121 0.09
122 0.1
123 0.13
124 0.18
125 0.27
126 0.32
127 0.38
128 0.42
129 0.52
130 0.53
131 0.54
132 0.56
133 0.53
134 0.53
135 0.53
136 0.55
137 0.46
138 0.44
139 0.39
140 0.32
141 0.29
142 0.24
143 0.2
144 0.13
145 0.13
146 0.12
147 0.13
148 0.13
149 0.11
150 0.1
151 0.08
152 0.09
153 0.09
154 0.09
155 0.08
156 0.11
157 0.15
158 0.15
159 0.16
160 0.15
161 0.14
162 0.15
163 0.18
164 0.17
165 0.13
166 0.14
167 0.15
168 0.14
169 0.16
170 0.18
171 0.22
172 0.26
173 0.3
174 0.35
175 0.39
176 0.44
177 0.51
178 0.51
179 0.5
180 0.46
181 0.42
182 0.39
183 0.36
184 0.3
185 0.24
186 0.22
187 0.17
188 0.16
189 0.19
190 0.18
191 0.19
192 0.27
193 0.33
194 0.4
195 0.46
196 0.55
197 0.61
198 0.69
199 0.75
200 0.77
201 0.79
202 0.82
203 0.87
204 0.88
205 0.88
206 0.91
207 0.94
208 0.94
209 0.94
210 0.95
211 0.95
212 0.94
213 0.94
214 0.9
215 0.89
216 0.89
217 0.87
218 0.83
219 0.77
220 0.72
221 0.69
222 0.65
223 0.62
224 0.57
225 0.51
226 0.51
227 0.51
228 0.47
229 0.42
230 0.43
231 0.4
232 0.39
233 0.35
234 0.28
235 0.27
236 0.25
237 0.24
238 0.26
239 0.28
240 0.32
241 0.41
242 0.47
243 0.54
244 0.64
245 0.7
246 0.74
247 0.79
248 0.8