Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TU92

Protein Details
Accession N4TU92    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-94EAAAENRPPKQRKKQSVKQEFFSQYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MILRKAGKSLDQRGASIVFQEQKIAVQKAQIAGLKPSGRCKDPNKAFPHVDNLIIARDRSEMNTCKLNDEAAAENRPPKQRKKQSVKQEFFSQYPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.36
3 0.29
4 0.26
5 0.2
6 0.18
7 0.18
8 0.16
9 0.18
10 0.22
11 0.23
12 0.19
13 0.18
14 0.19
15 0.19
16 0.22
17 0.21
18 0.17
19 0.17
20 0.21
21 0.22
22 0.22
23 0.28
24 0.28
25 0.28
26 0.33
27 0.36
28 0.42
29 0.46
30 0.54
31 0.52
32 0.54
33 0.53
34 0.49
35 0.49
36 0.4
37 0.33
38 0.25
39 0.2
40 0.16
41 0.15
42 0.14
43 0.09
44 0.09
45 0.09
46 0.11
47 0.15
48 0.16
49 0.18
50 0.25
51 0.24
52 0.25
53 0.25
54 0.24
55 0.19
56 0.19
57 0.21
58 0.18
59 0.21
60 0.2
61 0.23
62 0.29
63 0.37
64 0.4
65 0.46
66 0.54
67 0.62
68 0.72
69 0.79
70 0.83
71 0.86
72 0.91
73 0.88
74 0.83
75 0.82
76 0.76
77 0.69