Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U7N9

Protein Details
Accession N4U7N9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-128GGNRAFKAMGKKKQHWKSWRCECKDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, golg 4, mito 3, pero 3, E.R. 3, vacu 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MHFPYILPIVALGLGVANAAAIDDSDMLDTRAPKCEAGINLIRLDLRHGRSFTGFGKPGDCKNLPGNVKDFDIHSQGTKSLVPCFECTVYQASDCGPGDSETIGGNRAFKAMGKKKQHWKSWRCECKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.03
10 0.03
11 0.04
12 0.05
13 0.05
14 0.06
15 0.08
16 0.1
17 0.11
18 0.16
19 0.17
20 0.16
21 0.17
22 0.21
23 0.2
24 0.23
25 0.27
26 0.23
27 0.23
28 0.23
29 0.22
30 0.18
31 0.21
32 0.2
33 0.19
34 0.21
35 0.21
36 0.22
37 0.23
38 0.25
39 0.23
40 0.24
41 0.23
42 0.19
43 0.22
44 0.22
45 0.23
46 0.26
47 0.25
48 0.21
49 0.22
50 0.28
51 0.26
52 0.26
53 0.27
54 0.23
55 0.23
56 0.21
57 0.2
58 0.15
59 0.16
60 0.15
61 0.13
62 0.12
63 0.12
64 0.13
65 0.13
66 0.12
67 0.12
68 0.14
69 0.15
70 0.16
71 0.18
72 0.18
73 0.16
74 0.17
75 0.17
76 0.16
77 0.15
78 0.14
79 0.12
80 0.15
81 0.16
82 0.15
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.09
89 0.09
90 0.11
91 0.1
92 0.11
93 0.1
94 0.11
95 0.1
96 0.12
97 0.23
98 0.3
99 0.4
100 0.48
101 0.57
102 0.67
103 0.76
104 0.84
105 0.84
106 0.84
107 0.85
108 0.87