Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UG74

Protein Details
Accession N4UG74   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-124EELARLKRGKKRKAVPNPNKRFMTHydrophilic
169-190EENIPHQPLRRSRRVAKKTRVQHydrophilic
NLS Segment(s)
PositionSequence
105-117RLKRGKKRKAVPN
180-186SRRVAKK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MTKKNILSGWSVTGNWPISRAKALRHPEIQQDRPNGSPRVTPEPRLYLGSDDTPQTSRQIRDLGLNKTPKTRRRYNVIAKGFEAQQQTVAAHTQRIASLEEELARLKRGKKRKAVPNPNKRFMTLGETLASKECIPEGAIRYMPVGVEFVSSSEQESESEAGSVIEVREENIPHQPLRRSRRVAKKTRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.25
4 0.22
5 0.22
6 0.28
7 0.28
8 0.28
9 0.34
10 0.41
11 0.45
12 0.49
13 0.5
14 0.54
15 0.61
16 0.63
17 0.61
18 0.6
19 0.55
20 0.54
21 0.57
22 0.49
23 0.41
24 0.38
25 0.36
26 0.4
27 0.4
28 0.4
29 0.39
30 0.41
31 0.42
32 0.4
33 0.36
34 0.28
35 0.28
36 0.26
37 0.23
38 0.19
39 0.19
40 0.18
41 0.18
42 0.19
43 0.2
44 0.19
45 0.21
46 0.22
47 0.21
48 0.27
49 0.32
50 0.33
51 0.35
52 0.4
53 0.38
54 0.44
55 0.5
56 0.5
57 0.52
58 0.57
59 0.56
60 0.58
61 0.67
62 0.69
63 0.72
64 0.7
65 0.64
66 0.56
67 0.53
68 0.46
69 0.4
70 0.31
71 0.21
72 0.16
73 0.14
74 0.13
75 0.11
76 0.12
77 0.08
78 0.07
79 0.08
80 0.08
81 0.07
82 0.09
83 0.09
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.08
91 0.09
92 0.11
93 0.16
94 0.23
95 0.32
96 0.4
97 0.48
98 0.57
99 0.66
100 0.75
101 0.81
102 0.85
103 0.87
104 0.88
105 0.87
106 0.79
107 0.69
108 0.59
109 0.49
110 0.45
111 0.36
112 0.28
113 0.21
114 0.2
115 0.2
116 0.19
117 0.18
118 0.12
119 0.1
120 0.08
121 0.08
122 0.08
123 0.11
124 0.13
125 0.15
126 0.16
127 0.16
128 0.17
129 0.16
130 0.15
131 0.12
132 0.1
133 0.07
134 0.07
135 0.07
136 0.07
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.1
143 0.12
144 0.12
145 0.1
146 0.11
147 0.1
148 0.08
149 0.08
150 0.09
151 0.07
152 0.08
153 0.07
154 0.08
155 0.11
156 0.12
157 0.14
158 0.2
159 0.24
160 0.24
161 0.3
162 0.37
163 0.44
164 0.52
165 0.6
166 0.61
167 0.68
168 0.77
169 0.82
170 0.85