Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4UDX1

Protein Details
Accession N4UDX1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-90KPTVTKYKTKTKTVTKKPYPTYHKPGYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKILILIAPLLSLPLAFANSGGDYGYGYGEKISTVTATVTHTVTKPIYKAPITKTKTETVTNFKPTVTKYKTKTKTVTKKPYPTYHKPGYGDGKHKDGEYKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.06
5 0.07
6 0.07
7 0.07
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.08
25 0.09
26 0.09
27 0.1
28 0.1
29 0.12
30 0.13
31 0.13
32 0.12
33 0.12
34 0.16
35 0.16
36 0.19
37 0.22
38 0.31
39 0.33
40 0.36
41 0.37
42 0.38
43 0.39
44 0.39
45 0.38
46 0.35
47 0.38
48 0.39
49 0.36
50 0.33
51 0.32
52 0.31
53 0.37
54 0.36
55 0.37
56 0.38
57 0.48
58 0.55
59 0.6
60 0.66
61 0.67
62 0.72
63 0.76
64 0.82
65 0.81
66 0.83
67 0.84
68 0.86
69 0.84
70 0.83
71 0.81
72 0.78
73 0.76
74 0.69
75 0.68
76 0.68
77 0.66
78 0.65
79 0.6
80 0.57
81 0.52
82 0.5