Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U1E5

Protein Details
Accession N4U1E5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-35SAWTTTYTRIPKKQPKALRFLSHydrophilic
NLS Segment(s)
PositionSequence
105-109GRSHK
Subcellular Location(s) nucl 11.5, cyto_nucl 8.333, mito 8, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MSRSSVYSDDSRSSAWTTTYTRIPKKQPKALRFLSWVAGAPPGATAVKKRTRDYRDDRSVSSGGSTFSNWDQSDTQLYWVVHPNSYYYSGSSRGSTSSGHSKRSGRSHKSGGGSRKHFDGAVPRPVVQPMNMNGGPPPQHPPPPPMAPPMDGGYDGGPGYDAGYGDGIYDEGYDPNFGGGPPPAPMMGGYGGPPPPHMPPPPPMHPQMPGGMPGGAPFIDLTGQNHPGGRGGPSSESDGWSSEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.23
5 0.25
6 0.33
7 0.39
8 0.45
9 0.51
10 0.61
11 0.67
12 0.73
13 0.79
14 0.81
15 0.8
16 0.81
17 0.79
18 0.75
19 0.69
20 0.62
21 0.55
22 0.46
23 0.39
24 0.31
25 0.26
26 0.19
27 0.14
28 0.12
29 0.11
30 0.1
31 0.1
32 0.12
33 0.2
34 0.28
35 0.33
36 0.38
37 0.46
38 0.52
39 0.61
40 0.66
41 0.69
42 0.71
43 0.69
44 0.66
45 0.62
46 0.56
47 0.46
48 0.39
49 0.29
50 0.2
51 0.17
52 0.15
53 0.12
54 0.12
55 0.17
56 0.16
57 0.17
58 0.17
59 0.17
60 0.21
61 0.19
62 0.2
63 0.19
64 0.19
65 0.18
66 0.24
67 0.24
68 0.21
69 0.21
70 0.2
71 0.18
72 0.21
73 0.19
74 0.14
75 0.15
76 0.17
77 0.17
78 0.17
79 0.16
80 0.13
81 0.14
82 0.13
83 0.15
84 0.23
85 0.24
86 0.26
87 0.3
88 0.32
89 0.36
90 0.45
91 0.51
92 0.47
93 0.5
94 0.52
95 0.53
96 0.55
97 0.55
98 0.53
99 0.52
100 0.49
101 0.44
102 0.41
103 0.37
104 0.32
105 0.27
106 0.28
107 0.24
108 0.27
109 0.27
110 0.26
111 0.26
112 0.27
113 0.26
114 0.19
115 0.17
116 0.12
117 0.18
118 0.17
119 0.17
120 0.16
121 0.18
122 0.18
123 0.16
124 0.2
125 0.16
126 0.21
127 0.22
128 0.25
129 0.28
130 0.31
131 0.32
132 0.31
133 0.3
134 0.26
135 0.27
136 0.25
137 0.2
138 0.16
139 0.15
140 0.12
141 0.11
142 0.09
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.08
171 0.08
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.11
178 0.12
179 0.12
180 0.13
181 0.13
182 0.16
183 0.21
184 0.23
185 0.24
186 0.3
187 0.37
188 0.43
189 0.46
190 0.47
191 0.45
192 0.45
193 0.44
194 0.4
195 0.34
196 0.29
197 0.26
198 0.22
199 0.18
200 0.16
201 0.15
202 0.11
203 0.1
204 0.08
205 0.07
206 0.08
207 0.09
208 0.11
209 0.15
210 0.18
211 0.19
212 0.2
213 0.2
214 0.2
215 0.2
216 0.2
217 0.17
218 0.17
219 0.19
220 0.2
221 0.26
222 0.25
223 0.26
224 0.25
225 0.24