Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TYX4

Protein Details
Accession N4TYX4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-125LVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQBasic
NLS Segment(s)
PositionSequence
100-123LCRKRSKTGRKILLRRKIKGRRHI
Subcellular Location(s) mito 22.5, mito_nucl 13.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFSSITRLARPVLAKPLTQSPRTFTTLVPLRPSLTPMNGAIRRTALPSSFTPSTAASADIVPSSAISAHPALGDMQIRCGPRNTMNGHTRLVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.41
4 0.42
5 0.44
6 0.41
7 0.37
8 0.4
9 0.43
10 0.41
11 0.31
12 0.34
13 0.38
14 0.39
15 0.38
16 0.33
17 0.31
18 0.31
19 0.34
20 0.27
21 0.21
22 0.21
23 0.18
24 0.26
25 0.26
26 0.27
27 0.24
28 0.24
29 0.23
30 0.23
31 0.22
32 0.15
33 0.15
34 0.16
35 0.21
36 0.2
37 0.2
38 0.19
39 0.18
40 0.19
41 0.16
42 0.15
43 0.09
44 0.09
45 0.09
46 0.07
47 0.07
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.09
61 0.08
62 0.1
63 0.13
64 0.14
65 0.14
66 0.15
67 0.17
68 0.18
69 0.24
70 0.26
71 0.31
72 0.35
73 0.37
74 0.38
75 0.39
76 0.44
77 0.46
78 0.49
79 0.48
80 0.52
81 0.58
82 0.63
83 0.66
84 0.67
85 0.69
86 0.72
87 0.77
88 0.78
89 0.75
90 0.77
91 0.8
92 0.83
93 0.82
94 0.83
95 0.82
96 0.82
97 0.88
98 0.9
99 0.9
100 0.89
101 0.86
102 0.86
103 0.86
104 0.85
105 0.85