Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UI82

Protein Details
Accession N4UI82    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-70HPPPEPYAKKSRQCKRGRGGARBasic
NLS Segment(s)
PositionSequence
57-70KKSRQCKRGRGGAR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences HDSRAGKLDCCFEPIAWRSRPDRAEHRMLGFMPLSLLMKKLGRSLATAHPPPEPYAKKSRQCKRGRGGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.32
4 0.35
5 0.34
6 0.4
7 0.43
8 0.42
9 0.46
10 0.45
11 0.5
12 0.48
13 0.47
14 0.42
15 0.39
16 0.34
17 0.26
18 0.19
19 0.12
20 0.1
21 0.09
22 0.07
23 0.07
24 0.07
25 0.08
26 0.09
27 0.11
28 0.12
29 0.12
30 0.13
31 0.17
32 0.22
33 0.28
34 0.29
35 0.29
36 0.29
37 0.3
38 0.31
39 0.36
40 0.33
41 0.32
42 0.4
43 0.48
44 0.55
45 0.64
46 0.72
47 0.73
48 0.79
49 0.84
50 0.83