Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UDZ5

Protein Details
Accession N4UDZ5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-37IKEPCHSRRQQKTANCNQIQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MCNWNIYLWKCNCWTLAIKEPCHSRRQQKTANCNQIQQVKKEWVHIQDEPCVNHQANASLYVNGPTAKWEDIESTAYQSAKSLAERGEFPDFVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.4
4 0.42
5 0.41
6 0.44
7 0.52
8 0.52
9 0.54
10 0.55
11 0.54
12 0.58
13 0.65
14 0.68
15 0.68
16 0.75
17 0.79
18 0.83
19 0.74
20 0.66
21 0.62
22 0.62
23 0.56
24 0.48
25 0.42
26 0.38
27 0.37
28 0.38
29 0.36
30 0.31
31 0.33
32 0.33
33 0.3
34 0.28
35 0.3
36 0.27
37 0.26
38 0.26
39 0.21
40 0.2
41 0.19
42 0.16
43 0.14
44 0.17
45 0.16
46 0.13
47 0.14
48 0.13
49 0.14
50 0.12
51 0.11
52 0.09
53 0.11
54 0.1
55 0.11
56 0.11
57 0.12
58 0.13
59 0.16
60 0.15
61 0.17
62 0.19
63 0.18
64 0.17
65 0.16
66 0.16
67 0.15
68 0.16
69 0.15
70 0.15
71 0.18
72 0.19
73 0.23
74 0.27