Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UBU0

Protein Details
Accession N4UBU0    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-114LHEKNSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEBasic
146-168QEKLEKLDKKKKELHQEEKELKEBasic
NLS Segment(s)
PositionSequence
65-115KKRVRFKEDLHEKNSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEP
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEDNNASGSNTIKKGAAEELPENFAQNMPKLLAKCEPEEGHSESEEEQSQEDDSEEDEPKNDGTKKRVRFKEDLHEKNSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEPKSSRIDLFDSYTLRRLEGMWNKGFADLKDVQEKLEKLDKKKKELHQEEKELKEWLNRLHESIKNKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.23
5 0.25
6 0.25
7 0.28
8 0.27
9 0.26
10 0.23
11 0.21
12 0.19
13 0.17
14 0.16
15 0.15
16 0.18
17 0.18
18 0.2
19 0.24
20 0.25
21 0.26
22 0.3
23 0.29
24 0.28
25 0.32
26 0.32
27 0.28
28 0.26
29 0.25
30 0.2
31 0.21
32 0.2
33 0.16
34 0.13
35 0.12
36 0.12
37 0.11
38 0.1
39 0.08
40 0.08
41 0.1
42 0.11
43 0.1
44 0.11
45 0.11
46 0.11
47 0.16
48 0.19
49 0.19
50 0.25
51 0.34
52 0.42
53 0.51
54 0.57
55 0.59
56 0.6
57 0.62
58 0.66
59 0.68
60 0.66
61 0.61
62 0.64
63 0.6
64 0.64
65 0.67
66 0.6
67 0.52
68 0.56
69 0.62
70 0.64
71 0.72
72 0.74
73 0.76
74 0.82
75 0.89
76 0.89
77 0.9
78 0.89
79 0.88
80 0.87
81 0.88
82 0.88
83 0.89
84 0.9
85 0.89
86 0.89
87 0.89
88 0.88
89 0.87
90 0.88
91 0.86
92 0.86
93 0.84
94 0.84
95 0.8
96 0.76
97 0.72
98 0.68
99 0.64
100 0.64
101 0.61
102 0.56
103 0.56
104 0.55
105 0.54
106 0.5
107 0.47
108 0.39
109 0.35
110 0.33
111 0.28
112 0.25
113 0.25
114 0.23
115 0.21
116 0.19
117 0.17
118 0.23
119 0.28
120 0.34
121 0.31
122 0.32
123 0.32
124 0.34
125 0.35
126 0.26
127 0.25
128 0.21
129 0.23
130 0.28
131 0.27
132 0.26
133 0.3
134 0.31
135 0.29
136 0.35
137 0.37
138 0.39
139 0.49
140 0.55
141 0.58
142 0.67
143 0.7
144 0.73
145 0.78
146 0.8
147 0.8
148 0.84
149 0.84
150 0.8
151 0.74
152 0.65
153 0.56
154 0.51
155 0.45
156 0.41
157 0.41
158 0.38
159 0.39
160 0.44
161 0.48
162 0.51