Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U2N4

Protein Details
Accession N4U2N4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-187HDPEERRRRNQENRSRYRDRDBasic
217-236APRPTRRRRDSDIKERPRSYBasic
NLS Segment(s)
PositionSequence
223-224RR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDLDIEMDDAVDTVHDAPILDVGRDDILQPDEPEEPGEVAEDEPPTDDSKTLIPTKIHIKGVDSLHTSDIKAYVKAHFGDVDRIEWIDDSSANLLFPSEPTARDAIVALSSVPVADATALAIGETLPAKPFEGKPEISLQVRFAIQSDKKEVGAALRSRYYLLHPEHDPEERRRRNQENRSRYRDRDDGYHRGGEGRRRRASDDDVETFEASMYDDAPRPTRRRRDSDIKERPRSYARENQGKELFSGRKTQRDRSASPRRDNDGDDLMGERASSSGNRTRARDLKDRISGSNNSKELFPTKKSIKQFGGGNLDTLERAIGSARLKDEDRPKIVSVPNARGDGNSFNIRGMASQQGSGEGFAIKGAASANARELFPTKLGSTNTGKELFGGGRSKQRQKAEDLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.12
6 0.13
7 0.12
8 0.11
9 0.12
10 0.12
11 0.13
12 0.13
13 0.11
14 0.14
15 0.16
16 0.16
17 0.18
18 0.18
19 0.18
20 0.19
21 0.17
22 0.14
23 0.12
24 0.13
25 0.11
26 0.1
27 0.12
28 0.12
29 0.11
30 0.12
31 0.13
32 0.14
33 0.14
34 0.13
35 0.13
36 0.15
37 0.21
38 0.23
39 0.26
40 0.25
41 0.28
42 0.36
43 0.41
44 0.42
45 0.37
46 0.36
47 0.38
48 0.41
49 0.42
50 0.37
51 0.32
52 0.31
53 0.32
54 0.29
55 0.23
56 0.24
57 0.21
58 0.19
59 0.2
60 0.19
61 0.22
62 0.22
63 0.23
64 0.22
65 0.22
66 0.26
67 0.25
68 0.24
69 0.21
70 0.2
71 0.19
72 0.16
73 0.15
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.08
83 0.08
84 0.12
85 0.12
86 0.12
87 0.15
88 0.16
89 0.15
90 0.15
91 0.15
92 0.11
93 0.1
94 0.09
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.04
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.1
117 0.11
118 0.16
119 0.2
120 0.2
121 0.22
122 0.26
123 0.29
124 0.28
125 0.28
126 0.23
127 0.2
128 0.2
129 0.18
130 0.14
131 0.19
132 0.19
133 0.21
134 0.25
135 0.24
136 0.23
137 0.24
138 0.23
139 0.18
140 0.22
141 0.21
142 0.2
143 0.2
144 0.2
145 0.2
146 0.21
147 0.2
148 0.21
149 0.21
150 0.23
151 0.22
152 0.24
153 0.26
154 0.3
155 0.31
156 0.32
157 0.41
158 0.43
159 0.48
160 0.53
161 0.6
162 0.66
163 0.73
164 0.76
165 0.76
166 0.79
167 0.82
168 0.81
169 0.75
170 0.71
171 0.65
172 0.56
173 0.54
174 0.51
175 0.48
176 0.45
177 0.43
178 0.37
179 0.35
180 0.36
181 0.36
182 0.37
183 0.4
184 0.41
185 0.41
186 0.43
187 0.43
188 0.46
189 0.43
190 0.4
191 0.33
192 0.31
193 0.3
194 0.27
195 0.24
196 0.19
197 0.13
198 0.08
199 0.06
200 0.05
201 0.05
202 0.07
203 0.08
204 0.12
205 0.17
206 0.22
207 0.3
208 0.39
209 0.45
210 0.5
211 0.57
212 0.64
213 0.69
214 0.76
215 0.79
216 0.79
217 0.81
218 0.75
219 0.7
220 0.65
221 0.6
222 0.55
223 0.53
224 0.5
225 0.52
226 0.52
227 0.55
228 0.53
229 0.49
230 0.44
231 0.4
232 0.35
233 0.27
234 0.35
235 0.31
236 0.36
237 0.39
238 0.45
239 0.48
240 0.52
241 0.55
242 0.56
243 0.65
244 0.65
245 0.69
246 0.68
247 0.64
248 0.61
249 0.58
250 0.52
251 0.44
252 0.35
253 0.28
254 0.23
255 0.18
256 0.15
257 0.13
258 0.09
259 0.06
260 0.06
261 0.06
262 0.1
263 0.16
264 0.23
265 0.27
266 0.29
267 0.36
268 0.42
269 0.48
270 0.53
271 0.53
272 0.53
273 0.57
274 0.57
275 0.53
276 0.52
277 0.52
278 0.48
279 0.51
280 0.44
281 0.38
282 0.36
283 0.35
284 0.35
285 0.34
286 0.31
287 0.31
288 0.35
289 0.42
290 0.46
291 0.52
292 0.49
293 0.49
294 0.5
295 0.49
296 0.51
297 0.44
298 0.4
299 0.34
300 0.31
301 0.26
302 0.22
303 0.15
304 0.06
305 0.06
306 0.06
307 0.09
308 0.1
309 0.13
310 0.15
311 0.18
312 0.19
313 0.26
314 0.34
315 0.39
316 0.41
317 0.42
318 0.42
319 0.46
320 0.47
321 0.48
322 0.46
323 0.45
324 0.45
325 0.44
326 0.42
327 0.36
328 0.37
329 0.32
330 0.31
331 0.28
332 0.23
333 0.21
334 0.22
335 0.21
336 0.19
337 0.18
338 0.2
339 0.17
340 0.18
341 0.18
342 0.19
343 0.19
344 0.19
345 0.17
346 0.11
347 0.1
348 0.08
349 0.08
350 0.06
351 0.06
352 0.06
353 0.09
354 0.1
355 0.11
356 0.16
357 0.18
358 0.18
359 0.19
360 0.21
361 0.2
362 0.2
363 0.23
364 0.2
365 0.23
366 0.25
367 0.29
368 0.33
369 0.34
370 0.38
371 0.37
372 0.35
373 0.31
374 0.32
375 0.28
376 0.27
377 0.28
378 0.26
379 0.34
380 0.43
381 0.51
382 0.56
383 0.63
384 0.62
385 0.66