Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UCX5

Protein Details
Accession N4UCX5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-132GMLQLKRKIRNTRSARMWYRKHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006137  NADH_UbQ_OxRdtase-like_20kDa  
IPR006138  NADH_UQ_OxRdtase_20Kd_su  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
GO:0048038  F:quinone binding  
Pfam View protein in Pfam  
PF01058  Oxidored_q6  
Amino Acid Sequences MTFGLACCAVEMMHLSAPRYDQDRLGTFFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGVDRVAPVDIYIPGCPPTAEALMYGMLQLKRKIRNTRSARMWYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.17
5 0.19
6 0.21
7 0.2
8 0.19
9 0.23
10 0.26
11 0.29
12 0.3
13 0.3
14 0.27
15 0.28
16 0.31
17 0.32
18 0.29
19 0.28
20 0.3
21 0.3
22 0.3
23 0.27
24 0.23
25 0.19
26 0.18
27 0.14
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.11
39 0.14
40 0.14
41 0.15
42 0.16
43 0.17
44 0.18
45 0.21
46 0.19
47 0.18
48 0.19
49 0.19
50 0.17
51 0.16
52 0.15
53 0.12
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.12
72 0.1
73 0.1
74 0.1
75 0.11
76 0.13
77 0.14
78 0.13
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.1
88 0.11
89 0.1
90 0.1
91 0.12
92 0.12
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.12
100 0.13
101 0.16
102 0.21
103 0.26
104 0.34
105 0.42
106 0.53
107 0.55
108 0.64
109 0.69
110 0.75
111 0.78
112 0.8