Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4U4S9

Protein Details
Accession N4U4S9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-127RTTPVTKAEGKKRNRRKPRDKKNARRTKTEIBasic
NLS Segment(s)
PositionSequence
103-144KAEGKKRNRRKPRDKKNARRTKTEINREEKKRYMKVLERNRR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MPGTLIPPSSSEYCESDAITGSMLNDEGLYSAPLSGSLSSTHSVEEYFQPESRIQQACLYEEATSGILQDHRGSLSTATDSIPNSTPPEVSASIKTRTTPVTKAEGKKRNRRKPRDKKNARRTKTEINREEKKRYMKVLERNRRAAANCRARKQEQQDKLNAELEKLQDRHKELFASCNELRETAYQLKLQLLRHGDCGCALIQRFIANEAVNSVETLISKQSPSSSPNCTTASTTASAGASASSPRRGLGGNNGWDKPPGMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.2
5 0.18
6 0.15
7 0.13
8 0.1
9 0.09
10 0.09
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.08
24 0.08
25 0.11
26 0.12
27 0.12
28 0.13
29 0.12
30 0.12
31 0.13
32 0.15
33 0.15
34 0.17
35 0.18
36 0.2
37 0.2
38 0.22
39 0.27
40 0.26
41 0.24
42 0.26
43 0.27
44 0.26
45 0.27
46 0.25
47 0.18
48 0.16
49 0.16
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.1
64 0.1
65 0.1
66 0.12
67 0.12
68 0.13
69 0.14
70 0.14
71 0.15
72 0.15
73 0.14
74 0.13
75 0.16
76 0.15
77 0.16
78 0.2
79 0.21
80 0.23
81 0.24
82 0.24
83 0.22
84 0.24
85 0.25
86 0.23
87 0.23
88 0.28
89 0.34
90 0.4
91 0.48
92 0.53
93 0.58
94 0.66
95 0.74
96 0.77
97 0.82
98 0.86
99 0.88
100 0.91
101 0.93
102 0.95
103 0.95
104 0.95
105 0.96
106 0.96
107 0.88
108 0.85
109 0.79
110 0.78
111 0.76
112 0.75
113 0.72
114 0.69
115 0.74
116 0.7
117 0.7
118 0.64
119 0.61
120 0.54
121 0.49
122 0.48
123 0.46
124 0.51
125 0.57
126 0.62
127 0.61
128 0.62
129 0.6
130 0.57
131 0.51
132 0.5
133 0.49
134 0.49
135 0.48
136 0.49
137 0.53
138 0.53
139 0.58
140 0.59
141 0.59
142 0.57
143 0.57
144 0.58
145 0.56
146 0.56
147 0.54
148 0.44
149 0.35
150 0.29
151 0.25
152 0.26
153 0.24
154 0.25
155 0.25
156 0.28
157 0.3
158 0.29
159 0.3
160 0.25
161 0.3
162 0.27
163 0.31
164 0.28
165 0.28
166 0.27
167 0.25
168 0.25
169 0.2
170 0.24
171 0.2
172 0.22
173 0.2
174 0.2
175 0.24
176 0.27
177 0.26
178 0.27
179 0.27
180 0.26
181 0.29
182 0.29
183 0.25
184 0.21
185 0.22
186 0.17
187 0.16
188 0.15
189 0.12
190 0.13
191 0.13
192 0.14
193 0.14
194 0.15
195 0.12
196 0.11
197 0.11
198 0.12
199 0.11
200 0.1
201 0.09
202 0.08
203 0.08
204 0.09
205 0.11
206 0.1
207 0.11
208 0.11
209 0.14
210 0.16
211 0.2
212 0.24
213 0.28
214 0.3
215 0.35
216 0.36
217 0.35
218 0.35
219 0.33
220 0.32
221 0.27
222 0.24
223 0.21
224 0.19
225 0.17
226 0.14
227 0.13
228 0.1
229 0.12
230 0.15
231 0.16
232 0.16
233 0.17
234 0.18
235 0.19
236 0.21
237 0.27
238 0.33
239 0.38
240 0.44
241 0.45
242 0.45
243 0.45
244 0.43