Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UBD6

Protein Details
Accession N4UBD6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) mito 15, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVVLDKTTSEKLYKDVQSYRLVTIATLVDRMKINGSLARQCLADLEEKGIIKPVVTHSKMKIYSMASPPFSHEHSGPDALYPTNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.86
9 0.82
10 0.73
11 0.66
12 0.56
13 0.51
14 0.42
15 0.36
16 0.29
17 0.22
18 0.21
19 0.19
20 0.19
21 0.14
22 0.13
23 0.14
24 0.21
25 0.23
26 0.26
27 0.28
28 0.3
29 0.33
30 0.34
31 0.32
32 0.27
33 0.24
34 0.19
35 0.17
36 0.14
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.08
45 0.09
46 0.1
47 0.12
48 0.13
49 0.14
50 0.14
51 0.14
52 0.13
53 0.13
54 0.12
55 0.13
56 0.1
57 0.11
58 0.12
59 0.13
60 0.13
61 0.14
62 0.13
63 0.11
64 0.12
65 0.16
66 0.23
67 0.26
68 0.29
69 0.29
70 0.37
71 0.38
72 0.38
73 0.36
74 0.3
75 0.34
76 0.37
77 0.4
78 0.35
79 0.34
80 0.37
81 0.36
82 0.36
83 0.33
84 0.27
85 0.26
86 0.27
87 0.29
88 0.26
89 0.24
90 0.23