Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U9C8

Protein Details
Accession N4U9C8   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-57VNCRAAAWTTKKKKKKKKKKTQHHNQTNQHVSRHydrophilic
NLS Segment(s)
PositionSequence
35-44KKKKKKKKKK
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
Amino Acid Sequences MGATFQPLLDTSSESRTMAKLFYRVNCRAAAWTTKKKKKKKKKKTQHHNQTNQHVSRSRNIQSPNINTRDIAFDQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.17
6 0.17
7 0.19
8 0.21
9 0.26
10 0.33
11 0.35
12 0.36
13 0.35
14 0.33
15 0.3
16 0.29
17 0.31
18 0.31
19 0.38
20 0.46
21 0.54
22 0.63
23 0.71
24 0.79
25 0.83
26 0.87
27 0.89
28 0.9
29 0.92
30 0.95
31 0.96
32 0.97
33 0.97
34 0.96
35 0.95
36 0.92
37 0.9
38 0.88
39 0.78
40 0.72
41 0.65
42 0.57
43 0.52
44 0.51
45 0.45
46 0.42
47 0.44
48 0.45
49 0.49
50 0.55
51 0.57
52 0.54
53 0.52
54 0.46
55 0.44
56 0.43