Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UK08

Protein Details
Accession N4UK08    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-45DEPSVLSKKPAPKKKAKKVVADSWEDHydrophilic
129-157EQRAYQRSVREQEKKRREQEKEEAKKRQABasic
NLS Segment(s)
PositionSequence
27-37KKPAPKKKAKK
141-155EKKRREQEKEEAKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSQDQDVSSSLKNLSIDTKDEPSVLSKKPAPKKKAKKVVADSWEDSDSDSDAEPEVESESNKPTPTATPAPPPPTPMSPVSGLPWESPSGSPGPRAGADPDKRPEKTDAVARRMIAAGLGLKAPKQTEEQRAYQRSVREQEKKRREQEKEEAKKRQADVEKAKAAIWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.25
5 0.28
6 0.26
7 0.26
8 0.25
9 0.25
10 0.28
11 0.26
12 0.28
13 0.3
14 0.39
15 0.49
16 0.57
17 0.61
18 0.67
19 0.76
20 0.81
21 0.87
22 0.85
23 0.86
24 0.84
25 0.85
26 0.8
27 0.75
28 0.66
29 0.58
30 0.51
31 0.41
32 0.33
33 0.24
34 0.18
35 0.13
36 0.11
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.12
47 0.13
48 0.13
49 0.13
50 0.13
51 0.14
52 0.19
53 0.22
54 0.21
55 0.25
56 0.29
57 0.34
58 0.33
59 0.35
60 0.32
61 0.29
62 0.3
63 0.25
64 0.23
65 0.2
66 0.2
67 0.18
68 0.17
69 0.16
70 0.13
71 0.13
72 0.11
73 0.1
74 0.1
75 0.1
76 0.11
77 0.1
78 0.11
79 0.1
80 0.11
81 0.11
82 0.12
83 0.13
84 0.19
85 0.21
86 0.26
87 0.31
88 0.35
89 0.35
90 0.37
91 0.38
92 0.32
93 0.32
94 0.36
95 0.37
96 0.36
97 0.38
98 0.36
99 0.33
100 0.31
101 0.28
102 0.19
103 0.13
104 0.09
105 0.07
106 0.08
107 0.07
108 0.07
109 0.09
110 0.09
111 0.1
112 0.15
113 0.21
114 0.29
115 0.34
116 0.4
117 0.48
118 0.52
119 0.54
120 0.52
121 0.51
122 0.49
123 0.52
124 0.55
125 0.55
126 0.61
127 0.69
128 0.76
129 0.81
130 0.83
131 0.86
132 0.83
133 0.82
134 0.83
135 0.84
136 0.84
137 0.84
138 0.84
139 0.79
140 0.8
141 0.72
142 0.71
143 0.68
144 0.66
145 0.66
146 0.66
147 0.65
148 0.59
149 0.57