Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4U460

Protein Details
Accession N4U460    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-85QAKLTRANPKKMPKKMPKKNTEETDIHydrophilic
NLS Segment(s)
PositionSequence
65-78RANPKKMPKKMPKK
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MAINHGLQAQIFRLSSIRTKYPGYSNLIYDSNGKIINRPICGPKIQPRVFKKPDTVFYKQAKLTRANPKKMPKKMPKKNTEETDITWRTREHSDKNDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.24
4 0.26
5 0.26
6 0.28
7 0.31
8 0.35
9 0.38
10 0.39
11 0.36
12 0.34
13 0.34
14 0.33
15 0.3
16 0.27
17 0.23
18 0.18
19 0.18
20 0.16
21 0.15
22 0.2
23 0.22
24 0.22
25 0.23
26 0.24
27 0.24
28 0.26
29 0.28
30 0.31
31 0.38
32 0.41
33 0.48
34 0.51
35 0.58
36 0.61
37 0.59
38 0.56
39 0.5
40 0.54
41 0.53
42 0.52
43 0.5
44 0.5
45 0.52
46 0.49
47 0.48
48 0.44
49 0.42
50 0.45
51 0.48
52 0.53
53 0.55
54 0.6
55 0.67
56 0.73
57 0.77
58 0.8
59 0.79
60 0.82
61 0.86
62 0.89
63 0.88
64 0.87
65 0.88
66 0.83
67 0.79
68 0.72
69 0.65
70 0.64
71 0.59
72 0.52
73 0.45
74 0.39
75 0.36
76 0.4
77 0.43
78 0.41