Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U7X4

Protein Details
Accession N4U7X4   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-54ISDFGKRRRMQNRLAQRKYRNKVKRLAGSSHydrophilic
58-85EADKPRQKPTKCKRRSSASRSRKPRSTGBasic
NLS Segment(s)
PositionSequence
30-51KRRRMQNRLAQRKYRNKVKRLA
60-85DKPRQKPTKCKRRSSASRSRKPRSTG
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTQSAYAHPTSLRALIKPEEDWTKISDFGKRRRMQNRLAQRKYRNKVKRLAGSSDDVEADKPRQKPTKCKRRSSASRSRKPRSTGPRIPGVSQHQFNSPVKPTGEPGFPDTYDDQISSNEQFRLVCPVNPASIEIPLPLYDFTQPDIDIVTAGEYAASTVSSTVPMPPSLATHFSDSINSETYTSSDGFNPYMAYSNMTPMELNYLSLYDQLYLHVSHASKTLHEAARAPRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.29
5 0.32
6 0.31
7 0.31
8 0.31
9 0.3
10 0.28
11 0.3
12 0.3
13 0.33
14 0.35
15 0.43
16 0.52
17 0.55
18 0.62
19 0.67
20 0.73
21 0.74
22 0.76
23 0.78
24 0.79
25 0.82
26 0.82
27 0.83
28 0.86
29 0.87
30 0.87
31 0.86
32 0.81
33 0.81
34 0.81
35 0.81
36 0.75
37 0.72
38 0.65
39 0.59
40 0.53
41 0.45
42 0.37
43 0.27
44 0.23
45 0.19
46 0.2
47 0.21
48 0.23
49 0.29
50 0.37
51 0.41
52 0.51
53 0.6
54 0.67
55 0.71
56 0.78
57 0.79
58 0.81
59 0.87
60 0.86
61 0.86
62 0.86
63 0.86
64 0.86
65 0.86
66 0.82
67 0.76
68 0.75
69 0.74
70 0.73
71 0.72
72 0.66
73 0.67
74 0.62
75 0.58
76 0.54
77 0.5
78 0.46
79 0.4
80 0.36
81 0.3
82 0.33
83 0.33
84 0.32
85 0.28
86 0.25
87 0.24
88 0.23
89 0.23
90 0.21
91 0.22
92 0.18
93 0.2
94 0.18
95 0.17
96 0.19
97 0.18
98 0.16
99 0.15
100 0.14
101 0.11
102 0.1
103 0.11
104 0.1
105 0.11
106 0.1
107 0.1
108 0.1
109 0.1
110 0.15
111 0.15
112 0.15
113 0.15
114 0.16
115 0.16
116 0.16
117 0.17
118 0.11
119 0.11
120 0.1
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.08
128 0.08
129 0.09
130 0.1
131 0.09
132 0.09
133 0.09
134 0.08
135 0.07
136 0.07
137 0.06
138 0.05
139 0.04
140 0.04
141 0.03
142 0.04
143 0.04
144 0.04
145 0.03
146 0.04
147 0.04
148 0.05
149 0.06
150 0.07
151 0.08
152 0.09
153 0.09
154 0.09
155 0.11
156 0.13
157 0.16
158 0.16
159 0.18
160 0.19
161 0.19
162 0.2
163 0.19
164 0.19
165 0.18
166 0.17
167 0.14
168 0.13
169 0.14
170 0.15
171 0.14
172 0.13
173 0.12
174 0.14
175 0.13
176 0.14
177 0.13
178 0.12
179 0.14
180 0.13
181 0.15
182 0.13
183 0.17
184 0.17
185 0.17
186 0.16
187 0.14
188 0.19
189 0.16
190 0.17
191 0.13
192 0.13
193 0.13
194 0.14
195 0.15
196 0.1
197 0.1
198 0.1
199 0.11
200 0.11
201 0.12
202 0.15
203 0.15
204 0.15
205 0.2
206 0.2
207 0.18
208 0.23
209 0.3
210 0.29
211 0.3
212 0.34