Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UCT8

Protein Details
Accession N4UCT8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-139ETKTRTVTKYKTKTKVTKYKTKTKTVSKKPYPTYDNPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, E.R. 4, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKIFTLIAPLLSLPLVFASLGGDYGNGYGERVKTVTATVTHTVTKPAYKPPMTNTKTVTKYKPPTTKYKTETKTVTSYKPPTTKYKTETETVTRYKPPVTKYETKTRTVTKYKTKTKVTKYKTKTKTVSKKPYPTYDNPGYGDGGYKDGKKFKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.07
13 0.06
14 0.06
15 0.08
16 0.09
17 0.1
18 0.11
19 0.11
20 0.1
21 0.11
22 0.13
23 0.12
24 0.16
25 0.16
26 0.18
27 0.19
28 0.19
29 0.21
30 0.2
31 0.21
32 0.19
33 0.24
34 0.3
35 0.3
36 0.32
37 0.35
38 0.44
39 0.44
40 0.45
41 0.42
42 0.43
43 0.47
44 0.5
45 0.49
46 0.47
47 0.51
48 0.57
49 0.61
50 0.57
51 0.61
52 0.63
53 0.67
54 0.63
55 0.65
56 0.59
57 0.57
58 0.55
59 0.48
60 0.49
61 0.43
62 0.42
63 0.38
64 0.39
65 0.39
66 0.41
67 0.41
68 0.42
69 0.45
70 0.47
71 0.45
72 0.48
73 0.45
74 0.43
75 0.43
76 0.39
77 0.39
78 0.37
79 0.36
80 0.32
81 0.3
82 0.32
83 0.32
84 0.31
85 0.31
86 0.36
87 0.42
88 0.45
89 0.55
90 0.55
91 0.56
92 0.58
93 0.56
94 0.57
95 0.56
96 0.58
97 0.57
98 0.63
99 0.69
100 0.73
101 0.77
102 0.78
103 0.8
104 0.84
105 0.81
106 0.82
107 0.8
108 0.82
109 0.8
110 0.81
111 0.79
112 0.8
113 0.83
114 0.83
115 0.87
116 0.86
117 0.88
118 0.85
119 0.86
120 0.82
121 0.78
122 0.76
123 0.72
124 0.67
125 0.6
126 0.54
127 0.46
128 0.38
129 0.35
130 0.27
131 0.23
132 0.21
133 0.22
134 0.26