Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UF83

Protein Details
Accession N4UF83    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-122AKQTERDTSKIKRRRRSSIDKEBasic
NLS Segment(s)
PositionSequence
110-116KIKRRRR
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MSVPCPALPPGPKPEVRSQEHPHKLKSSGMSRGQNHDPLTTARHGLGFRNQQWGAFVVPRLHPFREKEKKGNTAGDYLGRDGTGCCDMEGARENESFKWEAKQTERDTSKIKRRRRSSIDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.58
4 0.61
5 0.62
6 0.66
7 0.73
8 0.71
9 0.66
10 0.62
11 0.57
12 0.53
13 0.53
14 0.48
15 0.46
16 0.49
17 0.53
18 0.51
19 0.55
20 0.54
21 0.51
22 0.47
23 0.39
24 0.33
25 0.26
26 0.27
27 0.23
28 0.2
29 0.15
30 0.17
31 0.17
32 0.17
33 0.22
34 0.25
35 0.25
36 0.31
37 0.31
38 0.28
39 0.28
40 0.28
41 0.22
42 0.16
43 0.16
44 0.11
45 0.13
46 0.17
47 0.18
48 0.19
49 0.21
50 0.23
51 0.32
52 0.4
53 0.43
54 0.47
55 0.51
56 0.56
57 0.57
58 0.59
59 0.5
60 0.42
61 0.39
62 0.34
63 0.29
64 0.23
65 0.2
66 0.14
67 0.13
68 0.1
69 0.12
70 0.1
71 0.09
72 0.08
73 0.09
74 0.09
75 0.11
76 0.16
77 0.15
78 0.15
79 0.17
80 0.18
81 0.18
82 0.22
83 0.21
84 0.18
85 0.21
86 0.22
87 0.26
88 0.3
89 0.39
90 0.4
91 0.49
92 0.5
93 0.5
94 0.54
95 0.58
96 0.63
97 0.63
98 0.68
99 0.69
100 0.74
101 0.81
102 0.84