Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U586

Protein Details
Accession N4U586   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-109KRQPIAKARPRKQRSSRGQSNPSTHydrophilic
NLS Segment(s)
PositionSequence
75-101KASTEKRGPAEKRQPIAKARPRKQRSS
Subcellular Location(s) nucl 13, cyto_nucl 10.666, mito_nucl 10.666, cyto_mito 7.666, mito 7, cyto 7
Family & Domain DBs
Amino Acid Sequences MSHNNWVAFTLPAYQVDLFRLRKILDGIYHGHFEVSLKSDEFIILAPRYLDPAERELVAEGSRYRRILEENKAVKASTEKRGPAEKRQPIAKARPRKQRSSRGQSNPSTEQCDSPDTSQIPLFDSVTQVVPSLEPKAHATPDQVLVVVENVTTDQSQAARPLRYSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.26
5 0.23
6 0.24
7 0.26
8 0.23
9 0.25
10 0.26
11 0.26
12 0.21
13 0.23
14 0.25
15 0.25
16 0.26
17 0.23
18 0.21
19 0.18
20 0.16
21 0.15
22 0.14
23 0.13
24 0.12
25 0.12
26 0.13
27 0.12
28 0.12
29 0.11
30 0.11
31 0.1
32 0.1
33 0.1
34 0.1
35 0.12
36 0.11
37 0.12
38 0.11
39 0.13
40 0.14
41 0.13
42 0.13
43 0.12
44 0.13
45 0.11
46 0.11
47 0.1
48 0.13
49 0.15
50 0.15
51 0.15
52 0.15
53 0.19
54 0.24
55 0.28
56 0.35
57 0.35
58 0.37
59 0.37
60 0.35
61 0.31
62 0.31
63 0.29
64 0.25
65 0.26
66 0.26
67 0.28
68 0.35
69 0.38
70 0.41
71 0.47
72 0.47
73 0.46
74 0.48
75 0.5
76 0.48
77 0.55
78 0.55
79 0.56
80 0.59
81 0.66
82 0.68
83 0.74
84 0.78
85 0.79
86 0.8
87 0.8
88 0.82
89 0.8
90 0.82
91 0.77
92 0.74
93 0.69
94 0.61
95 0.56
96 0.47
97 0.39
98 0.33
99 0.32
100 0.27
101 0.23
102 0.25
103 0.2
104 0.21
105 0.21
106 0.19
107 0.18
108 0.18
109 0.18
110 0.13
111 0.14
112 0.13
113 0.13
114 0.13
115 0.11
116 0.1
117 0.09
118 0.11
119 0.12
120 0.11
121 0.12
122 0.16
123 0.18
124 0.2
125 0.21
126 0.23
127 0.23
128 0.26
129 0.25
130 0.21
131 0.18
132 0.16
133 0.16
134 0.13
135 0.09
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.08
142 0.09
143 0.11
144 0.18
145 0.23
146 0.24