Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4UD94

Protein Details
Accession N4UD94   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
267-286TPPGRGIPKLSTRRRRHPHEBasic
NLS Segment(s)
PositionSequence
278-283TRRRRH
Subcellular Location(s) cyto 12, nucl 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR013105  TPR_2  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF12895  ANAPC3  
PF07719  TPR_2  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MAPTPTVASGLLRQVIYYHLDNASYHNGLFFAERLLAQDPRSSESTYLYALCHLRLGDFRSAYDVGKPIGYRGVHLGCAWVFAQACLALERYKDGISALEKARSLWASKCLPDAPAVLCLLGRLHRAYDDKKKAVACFEEALQLNPFMWDAFAALCDLGVIVRVPNVFKTSDTLVHSFDVETSPLISREGSVPIVPDIPMKKSQRNATMDVASDPFSSSHSPTIHELTNGDSGQEVDKSEFMQKIQEGRMRYATSTNSSSGFDGMETPPGRGIPKLSTRRRRHPHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.22
4 0.2
5 0.2
6 0.17
7 0.19
8 0.19
9 0.22
10 0.25
11 0.22
12 0.2
13 0.17
14 0.17
15 0.16
16 0.17
17 0.13
18 0.09
19 0.09
20 0.1
21 0.12
22 0.15
23 0.16
24 0.16
25 0.19
26 0.19
27 0.22
28 0.25
29 0.24
30 0.21
31 0.22
32 0.23
33 0.21
34 0.2
35 0.17
36 0.18
37 0.18
38 0.17
39 0.16
40 0.14
41 0.14
42 0.16
43 0.2
44 0.22
45 0.21
46 0.21
47 0.24
48 0.25
49 0.24
50 0.23
51 0.21
52 0.16
53 0.18
54 0.17
55 0.14
56 0.18
57 0.18
58 0.16
59 0.19
60 0.2
61 0.19
62 0.19
63 0.2
64 0.14
65 0.16
66 0.15
67 0.12
68 0.1
69 0.09
70 0.1
71 0.08
72 0.09
73 0.08
74 0.09
75 0.08
76 0.08
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.11
83 0.12
84 0.16
85 0.16
86 0.17
87 0.17
88 0.17
89 0.19
90 0.18
91 0.18
92 0.15
93 0.2
94 0.2
95 0.21
96 0.23
97 0.21
98 0.21
99 0.2
100 0.2
101 0.15
102 0.14
103 0.13
104 0.11
105 0.1
106 0.09
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.1
113 0.14
114 0.19
115 0.28
116 0.34
117 0.34
118 0.36
119 0.38
120 0.36
121 0.36
122 0.32
123 0.24
124 0.18
125 0.17
126 0.18
127 0.17
128 0.17
129 0.15
130 0.13
131 0.11
132 0.1
133 0.1
134 0.05
135 0.05
136 0.04
137 0.03
138 0.03
139 0.04
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.05
152 0.06
153 0.08
154 0.08
155 0.08
156 0.11
157 0.12
158 0.15
159 0.18
160 0.19
161 0.18
162 0.18
163 0.18
164 0.16
165 0.14
166 0.11
167 0.09
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.09
176 0.1
177 0.1
178 0.09
179 0.1
180 0.1
181 0.11
182 0.1
183 0.12
184 0.12
185 0.15
186 0.22
187 0.26
188 0.3
189 0.35
190 0.42
191 0.47
192 0.5
193 0.51
194 0.48
195 0.46
196 0.41
197 0.37
198 0.32
199 0.25
200 0.2
201 0.17
202 0.12
203 0.12
204 0.14
205 0.14
206 0.18
207 0.17
208 0.19
209 0.21
210 0.24
211 0.24
212 0.22
213 0.21
214 0.19
215 0.23
216 0.21
217 0.18
218 0.15
219 0.14
220 0.15
221 0.16
222 0.14
223 0.1
224 0.11
225 0.12
226 0.16
227 0.17
228 0.16
229 0.19
230 0.21
231 0.25
232 0.3
233 0.33
234 0.32
235 0.34
236 0.4
237 0.37
238 0.36
239 0.35
240 0.33
241 0.34
242 0.34
243 0.32
244 0.27
245 0.27
246 0.26
247 0.23
248 0.19
249 0.14
250 0.15
251 0.14
252 0.2
253 0.19
254 0.19
255 0.2
256 0.21
257 0.22
258 0.2
259 0.23
260 0.23
261 0.33
262 0.43
263 0.52
264 0.61
265 0.7
266 0.79