Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D3M8

Protein Details
Accession B0D3M8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
255-288LSKEEMKAAKQRERERRRRKKAKKKALEAQMTDDBasic
NLS Segment(s)
PositionSequence
259-279EMKAAKQRERERRRRKKAKKK
Subcellular Location(s) cyto_nucl 7.5, nucl 7, mito 6, cyto 6, pero 3, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0003747  F:translation release factor activity  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
KEGG lbc:LACBIDRAFT_315985  -  
Pfam View protein in Pfam  
PF00472  RF-1  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MTFDVANHNVTVFVHFVTVMSVSLALKASARSAYRDVWRASSALFAGDPPVLQAFRSKLRNDAVFAAEAAKDPETYERHNHLGREVAEFLRKNVVQAVKVSEQGDETWKIRLTKDTELGDNESIKNPPPIQSNRSARKREKGAPQTPGIDAALPESNRISTSPQTPLPQHYSALKKAHLQRSIPELREEDLEETFVRGSGPGGQSINKTENNVQLLHKPTGLRVSCQDTRSLSLNRKLARRWLLEKLDKLNNPGLSKEEMKAAKQRERERRRRKKAKKKALEAQMTDDEPDDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.1
6 0.08
7 0.07
8 0.08
9 0.08
10 0.09
11 0.1
12 0.09
13 0.09
14 0.1
15 0.11
16 0.15
17 0.16
18 0.19
19 0.21
20 0.27
21 0.31
22 0.37
23 0.37
24 0.36
25 0.36
26 0.33
27 0.3
28 0.27
29 0.21
30 0.16
31 0.14
32 0.11
33 0.11
34 0.11
35 0.1
36 0.08
37 0.1
38 0.09
39 0.09
40 0.13
41 0.15
42 0.22
43 0.28
44 0.28
45 0.31
46 0.36
47 0.39
48 0.37
49 0.37
50 0.32
51 0.27
52 0.26
53 0.22
54 0.17
55 0.15
56 0.14
57 0.11
58 0.09
59 0.09
60 0.15
61 0.16
62 0.2
63 0.25
64 0.27
65 0.32
66 0.35
67 0.35
68 0.31
69 0.34
70 0.31
71 0.29
72 0.27
73 0.23
74 0.26
75 0.26
76 0.25
77 0.26
78 0.25
79 0.21
80 0.24
81 0.25
82 0.21
83 0.22
84 0.27
85 0.22
86 0.24
87 0.24
88 0.19
89 0.18
90 0.17
91 0.19
92 0.16
93 0.15
94 0.15
95 0.18
96 0.18
97 0.19
98 0.23
99 0.24
100 0.25
101 0.3
102 0.29
103 0.28
104 0.29
105 0.31
106 0.27
107 0.24
108 0.21
109 0.16
110 0.15
111 0.15
112 0.16
113 0.14
114 0.15
115 0.2
116 0.23
117 0.26
118 0.34
119 0.42
120 0.49
121 0.57
122 0.62
123 0.59
124 0.63
125 0.65
126 0.63
127 0.64
128 0.65
129 0.62
130 0.59
131 0.57
132 0.52
133 0.45
134 0.39
135 0.29
136 0.19
137 0.13
138 0.11
139 0.11
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.11
147 0.1
148 0.13
149 0.16
150 0.18
151 0.2
152 0.21
153 0.25
154 0.28
155 0.27
156 0.25
157 0.27
158 0.29
159 0.32
160 0.33
161 0.31
162 0.32
163 0.38
164 0.44
165 0.44
166 0.41
167 0.38
168 0.44
169 0.48
170 0.43
171 0.37
172 0.31
173 0.28
174 0.28
175 0.27
176 0.2
177 0.14
178 0.14
179 0.12
180 0.11
181 0.1
182 0.09
183 0.08
184 0.06
185 0.06
186 0.1
187 0.11
188 0.12
189 0.13
190 0.14
191 0.15
192 0.19
193 0.23
194 0.19
195 0.21
196 0.22
197 0.26
198 0.27
199 0.27
200 0.26
201 0.27
202 0.31
203 0.29
204 0.29
205 0.24
206 0.24
207 0.31
208 0.3
209 0.27
210 0.26
211 0.32
212 0.35
213 0.35
214 0.37
215 0.3
216 0.33
217 0.36
218 0.38
219 0.37
220 0.39
221 0.44
222 0.46
223 0.49
224 0.49
225 0.52
226 0.54
227 0.53
228 0.52
229 0.55
230 0.59
231 0.61
232 0.63
233 0.61
234 0.62
235 0.57
236 0.56
237 0.53
238 0.49
239 0.43
240 0.4
241 0.36
242 0.32
243 0.33
244 0.3
245 0.31
246 0.29
247 0.31
248 0.37
249 0.42
250 0.45
251 0.51
252 0.6
253 0.63
254 0.72
255 0.8
256 0.84
257 0.88
258 0.92
259 0.95
260 0.96
261 0.97
262 0.97
263 0.97
264 0.97
265 0.96
266 0.94
267 0.93
268 0.92
269 0.83
270 0.79
271 0.73
272 0.63
273 0.54
274 0.44