Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KVX8

Protein Details
Accession R0KVX8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GNDIPKQQPSPKPKPKPTKETEKENSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.333, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGNDIPKQQPSPKPKPKPTKETEKENSMDDLFFVLKNMPNKSKGKEGKELYVEGDFETPKDNKLDKKKFKFVGLIKSSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.88
4 0.89
5 0.87
6 0.88
7 0.83
8 0.83
9 0.79
10 0.74
11 0.66
12 0.57
13 0.52
14 0.41
15 0.34
16 0.24
17 0.19
18 0.12
19 0.11
20 0.09
21 0.08
22 0.1
23 0.14
24 0.17
25 0.18
26 0.23
27 0.26
28 0.28
29 0.36
30 0.4
31 0.41
32 0.47
33 0.47
34 0.46
35 0.46
36 0.44
37 0.37
38 0.31
39 0.26
40 0.19
41 0.18
42 0.13
43 0.11
44 0.14
45 0.13
46 0.13
47 0.18
48 0.21
49 0.27
50 0.39
51 0.49
52 0.56
53 0.65
54 0.73
55 0.73
56 0.75
57 0.76
58 0.71
59 0.71
60 0.68