Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MNP8

Protein Details
Accession R0MNP8    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKGFKCSKCKTTNKIFNDCNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR033756  YlxH/NBP35  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF10609  ParA  
Amino Acid Sequences MKGFKCSKCKTTNKIFNDCNVKEKCSELGIRYLGYINMDTAYGKLSDQGLPFECEVLDKIVQKLLDKIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.7
4 0.71
5 0.63
6 0.61
7 0.53
8 0.47
9 0.39
10 0.38
11 0.32
12 0.26
13 0.27
14 0.19
15 0.21
16 0.2
17 0.19
18 0.18
19 0.17
20 0.14
21 0.12
22 0.11
23 0.07
24 0.06
25 0.06
26 0.06
27 0.05
28 0.06
29 0.06
30 0.05
31 0.06
32 0.08
33 0.1
34 0.11
35 0.13
36 0.14
37 0.16
38 0.16
39 0.15
40 0.14
41 0.12
42 0.13
43 0.13
44 0.14
45 0.14
46 0.15
47 0.18
48 0.19
49 0.2
50 0.26