Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MFA0

Protein Details
Accession R0MFA0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKPSLPRCRQENKKLLKTIKSFKKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003123  VPS9  
IPR037191  VPS9_dom_sf  
Pfam View protein in Pfam  
PF02204  VPS9  
PROSITE View protein in PROSITE  
PS51205  VPS9  
Amino Acid Sequences MKPSLPRCRQENKKLLKTIKSFKKDWRILEDHPLILKSFYEYVSLKFSIQCESEMLKIERNLSLNKLTQENSLLSSKILLYSWLEPRHLNVKGVDSLTNPILLIKDLNQKETVSEMIFKFLEVIKSIYESIKPQTDHSIFLSVLIVVILNSKSTSLEKMLYFMENFRRPSLAFCEDCKGKERPFDEGEVNYYLTVLKAALKFIKKMEFYDLKITKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.81
5 0.8
6 0.81
7 0.77
8 0.72
9 0.72
10 0.76
11 0.73
12 0.7
13 0.69
14 0.64
15 0.61
16 0.66
17 0.6
18 0.51
19 0.46
20 0.42
21 0.33
22 0.28
23 0.24
24 0.17
25 0.15
26 0.13
27 0.16
28 0.15
29 0.17
30 0.21
31 0.21
32 0.19
33 0.2
34 0.2
35 0.2
36 0.2
37 0.19
38 0.16
39 0.17
40 0.18
41 0.22
42 0.22
43 0.22
44 0.22
45 0.23
46 0.23
47 0.24
48 0.24
49 0.21
50 0.24
51 0.23
52 0.24
53 0.25
54 0.23
55 0.22
56 0.23
57 0.21
58 0.2
59 0.18
60 0.16
61 0.14
62 0.13
63 0.12
64 0.11
65 0.1
66 0.08
67 0.08
68 0.12
69 0.17
70 0.19
71 0.2
72 0.19
73 0.21
74 0.26
75 0.25
76 0.23
77 0.18
78 0.19
79 0.2
80 0.21
81 0.2
82 0.14
83 0.15
84 0.14
85 0.13
86 0.1
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.15
93 0.15
94 0.17
95 0.17
96 0.17
97 0.17
98 0.18
99 0.16
100 0.09
101 0.11
102 0.1
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.11
109 0.09
110 0.1
111 0.08
112 0.09
113 0.1
114 0.1
115 0.1
116 0.11
117 0.12
118 0.16
119 0.17
120 0.17
121 0.23
122 0.24
123 0.25
124 0.25
125 0.25
126 0.2
127 0.2
128 0.19
129 0.11
130 0.1
131 0.08
132 0.06
133 0.04
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.08
141 0.1
142 0.1
143 0.13
144 0.13
145 0.15
146 0.16
147 0.16
148 0.16
149 0.17
150 0.24
151 0.26
152 0.28
153 0.28
154 0.28
155 0.27
156 0.3
157 0.33
158 0.32
159 0.28
160 0.29
161 0.35
162 0.35
163 0.37
164 0.38
165 0.36
166 0.32
167 0.37
168 0.37
169 0.37
170 0.38
171 0.4
172 0.39
173 0.36
174 0.36
175 0.31
176 0.3
177 0.23
178 0.2
179 0.16
180 0.12
181 0.11
182 0.08
183 0.11
184 0.11
185 0.15
186 0.21
187 0.24
188 0.26
189 0.3
190 0.37
191 0.35
192 0.36
193 0.42
194 0.41
195 0.42
196 0.5
197 0.5