Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M410

Protein Details
Accession R0M410   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
189-208ETIKRVMKVVKKLKNNVEKMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21.5, cyto_nucl 13, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025721  Exosome_cplx_N_dom  
IPR026699  Exosome_RNA_bind1/RRP40/RRP4  
IPR036612  KH_dom_type_1_sf  
IPR012340  NA-bd_OB-fold  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000178  C:exosome (RNase complex)  
GO:0004527  F:exonuclease activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF14382  ECR1_N  
CDD cd05789  S1_Rrp4  
Amino Acid Sequences TVFLPGETICDSDDNIKGHGTQIVGKEIVSSYFGPSKIINKLVTVLPHMNYRYTPEVGDVVVGRVKEIYNKKWKIEMNCKTEVGLNLSAINLPGVAQRRKLESDEISMRTFFDINDLLVAEVQKVGKSGAVSLHTRNEKYKKLGEGVLVIMPVALVPHLKSRFITFTDLEVIIGSNGYVFVSPNDTNIETIKRVMKVVKKLKNNVEKMISINVDDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.18
5 0.19
6 0.2
7 0.18
8 0.17
9 0.18
10 0.21
11 0.2
12 0.2
13 0.2
14 0.18
15 0.17
16 0.16
17 0.14
18 0.14
19 0.18
20 0.18
21 0.18
22 0.19
23 0.23
24 0.25
25 0.29
26 0.26
27 0.22
28 0.25
29 0.25
30 0.25
31 0.25
32 0.24
33 0.21
34 0.25
35 0.25
36 0.24
37 0.22
38 0.26
39 0.26
40 0.24
41 0.23
42 0.19
43 0.19
44 0.17
45 0.18
46 0.13
47 0.1
48 0.11
49 0.1
50 0.09
51 0.09
52 0.09
53 0.15
54 0.2
55 0.27
56 0.36
57 0.4
58 0.41
59 0.47
60 0.51
61 0.52
62 0.58
63 0.59
64 0.55
65 0.55
66 0.54
67 0.48
68 0.46
69 0.38
70 0.31
71 0.23
72 0.17
73 0.13
74 0.13
75 0.13
76 0.11
77 0.09
78 0.05
79 0.04
80 0.06
81 0.11
82 0.12
83 0.15
84 0.16
85 0.19
86 0.21
87 0.22
88 0.23
89 0.19
90 0.23
91 0.25
92 0.26
93 0.24
94 0.22
95 0.21
96 0.18
97 0.17
98 0.12
99 0.09
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.07
116 0.08
117 0.11
118 0.13
119 0.14
120 0.2
121 0.22
122 0.24
123 0.3
124 0.33
125 0.34
126 0.37
127 0.41
128 0.38
129 0.37
130 0.38
131 0.33
132 0.29
133 0.26
134 0.22
135 0.17
136 0.13
137 0.1
138 0.08
139 0.06
140 0.05
141 0.03
142 0.03
143 0.04
144 0.12
145 0.13
146 0.14
147 0.15
148 0.18
149 0.21
150 0.23
151 0.26
152 0.2
153 0.21
154 0.24
155 0.23
156 0.2
157 0.17
158 0.15
159 0.11
160 0.1
161 0.07
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.11
169 0.11
170 0.13
171 0.16
172 0.17
173 0.18
174 0.2
175 0.22
176 0.18
177 0.22
178 0.25
179 0.23
180 0.25
181 0.3
182 0.35
183 0.42
184 0.51
185 0.57
186 0.62
187 0.69
188 0.77
189 0.81
190 0.79
191 0.75
192 0.7
193 0.63
194 0.57
195 0.55
196 0.46
197 0.36