Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KNV4

Protein Details
Accession R0KNV4   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-77SLNVLNKIYKRKKFKSFDEIIYLCSTKLKKGDKKAKRMIFKFHydrophilic
NLS Segment(s)
PositionSequence
64-71KKGDKKAK
Subcellular Location(s) nucl 16.5, cyto_nucl 14.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR021133  HEAT_type_2  
IPR038737  SF3b_su1-like  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003729  F:mRNA binding  
GO:0000245  P:spliceosomal complex assembly  
PROSITE View protein in PROSITE  
PS50077  HEAT_REPEAT  
Amino Acid Sequences MGAEIVDFLDKDALSYLGNIIWEKIDNLENDDLIESLNVLNKIYKRKKFKSFDEIIYLCSTKLKKGDKKAKRMIFKFLSNVIKSNLSQATNFNRLEFMRICFEATDCLTEVGEKSRRVIIDFVKTVGRFVNLQDLVDVFLIKLYESENYKGLIEVLAEISTKYGLFYVLPKILIKYEITSYSVRLRICKFLIEFIKLKNSIEEKYFATVITLIEDLILDKELEMRKSALKLISALVNTLAPPTIRTDIIIHLLNLSWFCVLDEIEFDECWECFMKTLGPDVLVKYLLQGLYHPNKKIRSKYENLYQKLVFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.09
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.12
11 0.14
12 0.16
13 0.15
14 0.2
15 0.21
16 0.19
17 0.19
18 0.19
19 0.16
20 0.13
21 0.12
22 0.08
23 0.07
24 0.11
25 0.11
26 0.11
27 0.15
28 0.19
29 0.3
30 0.39
31 0.47
32 0.54
33 0.62
34 0.72
35 0.77
36 0.81
37 0.81
38 0.78
39 0.75
40 0.73
41 0.65
42 0.57
43 0.52
44 0.44
45 0.33
46 0.31
47 0.27
48 0.21
49 0.28
50 0.36
51 0.4
52 0.51
53 0.61
54 0.66
55 0.76
56 0.82
57 0.83
58 0.84
59 0.79
60 0.77
61 0.72
62 0.66
63 0.59
64 0.56
65 0.55
66 0.46
67 0.45
68 0.38
69 0.35
70 0.31
71 0.33
72 0.29
73 0.23
74 0.23
75 0.25
76 0.29
77 0.33
78 0.33
79 0.28
80 0.27
81 0.26
82 0.29
83 0.26
84 0.22
85 0.19
86 0.2
87 0.2
88 0.18
89 0.18
90 0.16
91 0.15
92 0.14
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.14
99 0.18
100 0.16
101 0.17
102 0.2
103 0.2
104 0.21
105 0.24
106 0.22
107 0.24
108 0.24
109 0.24
110 0.24
111 0.24
112 0.23
113 0.2
114 0.18
115 0.12
116 0.11
117 0.18
118 0.15
119 0.15
120 0.15
121 0.14
122 0.14
123 0.14
124 0.13
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.07
132 0.08
133 0.1
134 0.1
135 0.11
136 0.11
137 0.11
138 0.1
139 0.08
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.06
154 0.08
155 0.09
156 0.1
157 0.1
158 0.11
159 0.11
160 0.12
161 0.11
162 0.1
163 0.1
164 0.11
165 0.13
166 0.13
167 0.15
168 0.17
169 0.2
170 0.19
171 0.22
172 0.22
173 0.24
174 0.24
175 0.25
176 0.22
177 0.24
178 0.27
179 0.27
180 0.27
181 0.24
182 0.3
183 0.27
184 0.27
185 0.25
186 0.25
187 0.23
188 0.23
189 0.24
190 0.18
191 0.2
192 0.2
193 0.16
194 0.14
195 0.13
196 0.11
197 0.1
198 0.09
199 0.07
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.04
207 0.09
208 0.11
209 0.12
210 0.13
211 0.14
212 0.16
213 0.17
214 0.21
215 0.18
216 0.17
217 0.17
218 0.17
219 0.19
220 0.17
221 0.16
222 0.14
223 0.12
224 0.11
225 0.11
226 0.1
227 0.07
228 0.08
229 0.11
230 0.13
231 0.13
232 0.14
233 0.15
234 0.16
235 0.2
236 0.2
237 0.17
238 0.15
239 0.15
240 0.15
241 0.13
242 0.12
243 0.08
244 0.07
245 0.07
246 0.08
247 0.08
248 0.07
249 0.08
250 0.1
251 0.12
252 0.11
253 0.12
254 0.12
255 0.12
256 0.13
257 0.14
258 0.11
259 0.1
260 0.11
261 0.14
262 0.13
263 0.18
264 0.18
265 0.18
266 0.19
267 0.2
268 0.22
269 0.19
270 0.18
271 0.15
272 0.17
273 0.16
274 0.14
275 0.14
276 0.21
277 0.3
278 0.36
279 0.4
280 0.43
281 0.51
282 0.6
283 0.67
284 0.69
285 0.68
286 0.7
287 0.74
288 0.78
289 0.79
290 0.75
291 0.73