Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MEV8

Protein Details
Accession R0MEV8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-50IEERSIKKIKKEKPKFRNIKNGFTHydrophilic
NLS Segment(s)
PositionSequence
31-44SIKKIKKEKPKFRN
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR004015  SKI-int_prot_SKIP_SNW-dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02731  SKIP_SNW  
Amino Acid Sequences MTLVKKIFLEGKKVRRLEIPLQDPCKIEERSIKKIKKEKPKFRNIKNGFTIPRVISMWKNPTSKLISLEDRAKHFGKKKSVEVNLKGFMNLSESLDRIEKMCKEKCLEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.57
4 0.56
5 0.57
6 0.55
7 0.55
8 0.57
9 0.58
10 0.53
11 0.49
12 0.47
13 0.38
14 0.33
15 0.33
16 0.36
17 0.43
18 0.52
19 0.54
20 0.56
21 0.64
22 0.7
23 0.73
24 0.78
25 0.79
26 0.79
27 0.86
28 0.87
29 0.86
30 0.89
31 0.82
32 0.79
33 0.73
34 0.69
35 0.6
36 0.52
37 0.46
38 0.35
39 0.32
40 0.24
41 0.21
42 0.16
43 0.18
44 0.22
45 0.25
46 0.26
47 0.24
48 0.28
49 0.3
50 0.3
51 0.29
52 0.27
53 0.24
54 0.27
55 0.32
56 0.31
57 0.3
58 0.33
59 0.31
60 0.33
61 0.38
62 0.42
63 0.45
64 0.47
65 0.52
66 0.56
67 0.64
68 0.66
69 0.65
70 0.63
71 0.58
72 0.53
73 0.46
74 0.38
75 0.29
76 0.24
77 0.19
78 0.17
79 0.14
80 0.14
81 0.16
82 0.17
83 0.18
84 0.15
85 0.2
86 0.23
87 0.29
88 0.34
89 0.38
90 0.41