Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MCS2

Protein Details
Accession R0MCS2    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-61KTENNKGRRFLKCKKAYKPCKFFEWAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, cyto_nucl 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010666  Znf_GRF  
Gene Ontology GO:0016853  F:isomerase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51999  ZF_GRF  
Amino Acid Sequences MYYTCSEGVKKCGYFKWALKDGKCHCGFDPIELVSKTENNKGRRFLKCKKAYKPCKFFEWAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.44
4 0.46
5 0.5
6 0.48
7 0.54
8 0.54
9 0.57
10 0.54
11 0.47
12 0.38
13 0.4
14 0.39
15 0.31
16 0.3
17 0.21
18 0.22
19 0.2
20 0.2
21 0.14
22 0.16
23 0.16
24 0.21
25 0.27
26 0.29
27 0.33
28 0.4
29 0.47
30 0.54
31 0.61
32 0.63
33 0.67
34 0.73
35 0.78
36 0.81
37 0.85
38 0.87
39 0.89
40 0.9
41 0.84
42 0.81