Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0ML23

Protein Details
Accession R0ML23   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTHFKKKKFNRNDNFNAKPKELHydrophilic
160-179KDKRGFNRSFGDRKKQWNKKBasic
NLS Segment(s)
PositionSequence
109-179EKKKEEGDKKIKDGKGIKGNGDRKGRDFKSKGDFKDKHDFKDKHDFKGRDVKDKRGFNRSFGDRKKQWNKK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MTHFKKKKFNRNDNFNAKPKELGSFLHFCEDLIIVKVSNCDYIPFPNALVLNKDHKVIGKVDEVLGPQNEVYVAIKREIKEDYDLKSKFYCYENKFIPKERFMERSEVEKKKEEGDKKIKDGKGIKGNGDRKGRDFKSKGDFKDKHDFKDKHDFKGRDVKDKRGFNRSFGDRKKQWNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.82
4 0.72
5 0.65
6 0.55
7 0.48
8 0.4
9 0.34
10 0.3
11 0.29
12 0.28
13 0.29
14 0.27
15 0.23
16 0.23
17 0.21
18 0.16
19 0.14
20 0.14
21 0.1
22 0.11
23 0.12
24 0.12
25 0.13
26 0.12
27 0.11
28 0.12
29 0.14
30 0.17
31 0.16
32 0.15
33 0.16
34 0.17
35 0.16
36 0.17
37 0.18
38 0.2
39 0.21
40 0.21
41 0.19
42 0.19
43 0.21
44 0.2
45 0.2
46 0.17
47 0.17
48 0.17
49 0.17
50 0.17
51 0.16
52 0.15
53 0.12
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.08
60 0.09
61 0.11
62 0.13
63 0.14
64 0.16
65 0.16
66 0.16
67 0.18
68 0.2
69 0.21
70 0.27
71 0.27
72 0.27
73 0.26
74 0.26
75 0.23
76 0.24
77 0.28
78 0.23
79 0.29
80 0.32
81 0.38
82 0.4
83 0.44
84 0.45
85 0.4
86 0.41
87 0.38
88 0.39
89 0.33
90 0.37
91 0.31
92 0.36
93 0.42
94 0.42
95 0.42
96 0.41
97 0.41
98 0.41
99 0.47
100 0.44
101 0.45
102 0.51
103 0.53
104 0.55
105 0.63
106 0.58
107 0.57
108 0.57
109 0.55
110 0.54
111 0.51
112 0.5
113 0.51
114 0.55
115 0.56
116 0.58
117 0.52
118 0.48
119 0.55
120 0.53
121 0.54
122 0.51
123 0.5
124 0.53
125 0.58
126 0.59
127 0.6
128 0.61
129 0.58
130 0.67
131 0.64
132 0.6
133 0.64
134 0.61
135 0.56
136 0.64
137 0.61
138 0.59
139 0.66
140 0.61
141 0.55
142 0.64
143 0.61
144 0.61
145 0.61
146 0.62
147 0.61
148 0.69
149 0.69
150 0.69
151 0.68
152 0.62
153 0.67
154 0.65
155 0.66
156 0.65
157 0.69
158 0.66
159 0.75