Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KVQ9

Protein Details
Accession R0KVQ9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-39TSCTFGKKRCCGKWNKTQTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
Amino Acid Sequences MVINRIEEDMEIVEENEIVTSCTFGKKRCCGKWNKTQTEQFYEALRLCGLEFTLISNLFENKNRRACKLKYLSELKRNKKKVEEILSDLQPFNREKYESLKNQLQNTKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.07
9 0.13
10 0.15
11 0.19
12 0.27
13 0.35
14 0.45
15 0.52
16 0.6
17 0.64
18 0.71
19 0.77
20 0.8
21 0.79
22 0.78
23 0.76
24 0.73
25 0.7
26 0.64
27 0.54
28 0.45
29 0.39
30 0.31
31 0.25
32 0.2
33 0.13
34 0.1
35 0.09
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.14
47 0.17
48 0.21
49 0.29
50 0.3
51 0.34
52 0.4
53 0.41
54 0.46
55 0.51
56 0.51
57 0.52
58 0.59
59 0.63
60 0.65
61 0.73
62 0.73
63 0.75
64 0.75
65 0.72
66 0.7
67 0.71
68 0.7
69 0.7
70 0.65
71 0.62
72 0.62
73 0.6
74 0.55
75 0.48
76 0.39
77 0.34
78 0.3
79 0.26
80 0.24
81 0.22
82 0.22
83 0.29
84 0.37
85 0.4
86 0.47
87 0.52
88 0.54
89 0.61