Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MKZ4

Protein Details
Accession R0MKZ4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-158FIGSSDDKEKNKKRKRRNAQKTVNEQPKQANENKSKKGPYKITLVKKKQKNHydrophilic
NLS Segment(s)
PositionSequence
115-158KEKNKKRKRRNAQKTVNEQPKQANENKSKKGPYKITLVKKKQKN
Subcellular Location(s) nucl 9.5, cyto_nucl 9, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MKCFIVFILLSNIKGVFDKNTNVNSSPTGERIHKVIYPSALPVTSRNGARSSNKTTKVVDKETAIKKAIMEVGPKVLIYNIVKGNIELTVLDEDEAKELVKKLIELGFIGSSDDKEKNKKRKRRNAQKTVNEQPKQANENKSKKGPYKITLVKKKQKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.14
4 0.16
5 0.2
6 0.24
7 0.28
8 0.3
9 0.31
10 0.32
11 0.3
12 0.3
13 0.29
14 0.26
15 0.26
16 0.25
17 0.24
18 0.25
19 0.26
20 0.24
21 0.24
22 0.24
23 0.22
24 0.21
25 0.21
26 0.2
27 0.18
28 0.17
29 0.16
30 0.18
31 0.2
32 0.2
33 0.2
34 0.21
35 0.24
36 0.29
37 0.33
38 0.37
39 0.42
40 0.44
41 0.45
42 0.45
43 0.49
44 0.5
45 0.47
46 0.4
47 0.35
48 0.39
49 0.4
50 0.42
51 0.35
52 0.29
53 0.25
54 0.25
55 0.25
56 0.18
57 0.16
58 0.13
59 0.13
60 0.13
61 0.13
62 0.11
63 0.08
64 0.1
65 0.09
66 0.12
67 0.11
68 0.12
69 0.12
70 0.12
71 0.12
72 0.09
73 0.09
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.07
89 0.09
90 0.1
91 0.11
92 0.1
93 0.11
94 0.1
95 0.1
96 0.11
97 0.09
98 0.08
99 0.11
100 0.15
101 0.16
102 0.25
103 0.34
104 0.45
105 0.55
106 0.64
107 0.73
108 0.8
109 0.89
110 0.91
111 0.94
112 0.94
113 0.94
114 0.95
115 0.93
116 0.92
117 0.91
118 0.82
119 0.73
120 0.69
121 0.65
122 0.61
123 0.58
124 0.57
125 0.57
126 0.64
127 0.69
128 0.7
129 0.71
130 0.72
131 0.75
132 0.73
133 0.67
134 0.68
135 0.7
136 0.74
137 0.77
138 0.8