Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MCT9

Protein Details
Accession R0MCT9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
29-50VNTTIRKRYRKQNKQYLICHDEHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, mito 5, plas 5, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASLNFCNSSYVMISFLFIMLAIYIGFIVNTTIRKRYRKQNKQYLICHDEVELPIEEVINIKEERNRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.08
5 0.06
6 0.05
7 0.04
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.05
17 0.07
18 0.09
19 0.15
20 0.19
21 0.25
22 0.29
23 0.4
24 0.5
25 0.58
26 0.68
27 0.73
28 0.78
29 0.82
30 0.83
31 0.82
32 0.76
33 0.66
34 0.56
35 0.46
36 0.39
37 0.3
38 0.27
39 0.18
40 0.13
41 0.12
42 0.12
43 0.11
44 0.09
45 0.1
46 0.11
47 0.11
48 0.12
49 0.18